ARID1B monoclonal antibody (M02), clone 2F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARID1B.
Immunogen
ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ARID1B monoclonal antibody (M02), clone 2F2 Western Blot analysis of ARID1B expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARID1B is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ARID1B on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ARID1B
Entrez GeneID
57492GeneBank Accession#
NM_017519Protein Accession#
NP_059989Gene Name
ARID1B
Gene Alias
6A3-5, BAF250b, BRIGHT, DAN15, ELD/OSA1, KIAA1235, p250R
Gene Description
AT rich interactive domain 1B (SWI1-like)
Gene Ontology
HyperlinkOther Designations
BRG1-binding protein ELD/OSA1|Eld (eyelid)/Osa protein|OTTHUMP00000040115
-
Interactome
-
Disease
-
Publication Reference
-
Differential roles of ARID1B in excitatory and inhibitory neural progenitors in the developing cortex.
Jeffrey J Moffat, Eui-Man Jung, Minhan Ka, Byeong Tak Jeon, Hyunkyoung Lee, Woo-Yang Kim.
Scientific Reports 2021 Feb; 11(1):3856.
Application:WB-Ti, WB-Tr, Mouse, Mouse brain.
-
Arid1b haploinsufficiency disrupts cortical interneuron development and mouse behavior.
Jung EM, Moffat JJ, Liu J, Dravid SM, Gurumurthy CB, Kim WY.
Nature Neuroscience 2017 Dec; 20(12):1694.
Application:IHC, WB-Ti, Mouse, Mouse brain tissues.
-
Dynamics of expression of ARID1A and ARID1B subunits in mouse embryos and in cells during the cell cycle.
Flores-Alcantar A, Gonzalez-Sandoval A, Escalante-Alcalde D, Lomeli H.
Cell and Tissue Research 2011 Jul; 345(1):137.
Application:IF, Mouse, MC3T3 cells.
-
Differential roles of ARID1B in excitatory and inhibitory neural progenitors in the developing cortex.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com