AHRR monoclonal antibody (M01), clone 5G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
AHRR monoclonal antibody (M01), clone 5G11. Western Blot analysis of AHRR expression in A-431.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AHRR is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AHRR.
Immunogen
AHRR (NP_065782, 617 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (58); Rat (58)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AHRR monoclonal antibody (M01), clone 5G11. Western Blot analysis of AHRR expression in A-431.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AHRR is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — AHRR
Entrez GeneID
57491GeneBank Accession#
NM_020731Protein Accession#
NP_065782Gene Name
AHRR
Gene Alias
AHH, AHHR, KIAA1234, MGC167813, MGC176630, bHLHe77
Gene Description
aryl-hydrocarbon receptor repressor
Omim ID
606517Gene Ontology
HyperlinkGene Summary
Dioxin is a teratogen that exerts its effects through the arylhydrocarbon receptor in conjunction with the receptor's binding partner, arylhydrocarbon receptor nuclear translocator. The protein encoded by this gene represses signal transduction by the arylhydrocarbon receptor by competing with the arylhydrocarbon receptor nuclear translocator for binding to the arylhydrocarbon receptor. Expression of the repressor is stimulated by the receptor/translocator heterodimer, thereby regulating receptor function through a negative feedback mechanism. In addition, the encoded protein can bind to nuclear factor kappa-B. [provided by RefSeq
Other Designations
aryl hydrocarbon hydroxylase regulator|aryl hydrocarbon receptor regulator|arylhydrocarbon receptor repressor|dioxin receptor repressor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com