Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HHATL monoclonal antibody (M07A), clone 2B7

  • Catalog # : H00057467-M07A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant HHATL.
  • Immunogen:
  • HHATL (NP_065758.2, 157 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLAD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • HHATL
  • Gene Alias:
  • C3orf3,GUP1,KIAA1173,MBOAT3,MSTP002,OACT3
  • Gene Description:
  • hedgehog acyltransferase-like
  • Other Designations:
  • GUP1 glycerol uptake/transporter homolog,GUP1, glycerol uptake/transporter homolog,OTTHUMP00000164037,membrane bound O-acyltransferase domain containing 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook