GATAD2B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GATAD2B polyclonal antibody (A01), Lot # 051114JC01. Western Blot analysis of GATAD2B expression in NIH/3T3.
Western Blot (Cell lysate)
GATAD2B polyclonal antibody (A01), Lot # 051114JC01 Western Blot analysis of GATAD2B expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot detection against Immunogen (37.99 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant GATAD2B.
Immunogen
GATAD2B (NP_065750, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Sequence
RMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.99 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GATAD2B polyclonal antibody (A01), Lot # 051114JC01. Western Blot analysis of GATAD2B expression in NIH/3T3.Western Blot (Cell lysate)
GATAD2B polyclonal antibody (A01), Lot # 051114JC01 Western Blot analysis of GATAD2B expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — GATAD2B
Entrez GeneID
57459GeneBank Accession#
NM_020699Protein Accession#
NP_065750Gene Name
GATAD2B
Gene Alias
FLJ37346, KIAA1150, MGC138257, MGC138285, P66beta, RP11-216N14.6
Gene Description
GATA zinc finger domain containing 2B
Gene Ontology
HyperlinkOther Designations
OTTHUMP00000035272|transcription repressor p66 beta component of the MeCP1 complex
-
Interactome
-
Publication Reference
-
FBXO44 promotes DNA replication-coupled repetitive element silencing in cancer cells.
Jia Z Shen, Zhixin Qiu, Qiulian Wu, Darren Finlay, Guillermina Garcia, Dahui Sun, Juha Rantala, William Barshop, Jennifer L Hope, Ryan C Gimple, Olle Sangfelt, Linda M Bradley, James Wohlschlegel, Jeremy N Rich, Charles Spruck.
Cell 2021 Jan; 184(2):352.
Application：WB-Tr, Human, MDA-MB-231 cells.
-
FBXO44 promotes DNA replication-coupled repetitive element silencing in cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com