PLEKHG5 monoclonal antibody (M01), clone 5A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PLEKHG5 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PLEKHG5 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PLEKHG5 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PLEKHG5.
Immunogen
PLEKHG5 (NP_065682, 896 a.a. ~ 995 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (84)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PLEKHG5 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PLEKHG5 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PLEKHG5 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PLEKHG5
Entrez GeneID
57449GeneBank Accession#
NM_020631Protein Accession#
NP_065682Gene Name
PLEKHG5
Gene Alias
DSMA4, GEF720, KIAA0720, RP4-650H14.3
Gene Description
pleckstrin homology domain containing, family G (with RhoGef domain) member 5
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that activates the nuclear factor kappa B (NFKB1) signaling pathway. Multations in this gene have been found in a family with distal spinal muscular atrophy. [provided by RefSeq
Other Designations
NFkB activating protein|OTTHUMP00000001050|OTTHUMP00000001051|OTTHUMP00000001054|novel PH domain-containing protein|pleckstrin homology domain containing family G member 5
-
Interactome
-
Disease
-
Publication Reference
-
PLEKHG5 regulates autophagy, survival and MGMT expression in U251-MG glioblastoma cells.
Kaya Elisa Witte, Carsten Slotta, Melanie Lütkemeyer, Angelika Kitke, Roland Coras, Matthias Simon, Christian Kaltschmidt, Barbara Kaltschmidt.
Scientific Reports 2020 Dec; 10(1):21858.
Application：IF, WB-Tr, Human, U251-MG cells.
-
Phosphorylation-mediated 14-3-3 Protein Binding Regulates the Function of the Rho-specific Guanine Nucleotide Exchange Factor (RhoGEF) Syx.
Ngok SP, Geyer R, Kourtidis A, Storz P, Anastasiadis PZ.
The Journal of Biological Chemistry 2013 Mar; 288(9):6640.
Application：IP-WB, Human, Hela cells.
-
VEGF and Angiopoietin-1 exert opposing effects on cell junctions by regulating the Rho GEF Syx.
Ngok SP, Geyer R, Liu M, Kourtidis A, Agrawal S, Wu C, Seerapu HR, Lewis-Tuffin LJ, Moodie KL, Huveldt D, Marx R, Baraban JM, Storz P, Horowitz A, Anastasiadis PZ.
International Journal of Cell Biology 2012 Dec; 199(7):1103.
Application：WB, Human, HUVEC.
-
PLEKHG5 regulates autophagy, survival and MGMT expression in U251-MG glioblastoma cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com