NDRG2 monoclonal antibody (M03), clone 6A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NDRG2.
Immunogen
NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDRG2 monoclonal antibody (M03), clone 6A5. Western Blot analysis of NDRG2 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of NDRG2 expression in transfected 293T cell line by NDRG2 monoclonal antibody (M03), clone 6A5.
Lane 1: NDRG2 transfected lysate(39.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDRG2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — NDRG2
Entrez GeneID
57447GeneBank Accession#
NM_016250Protein Accession#
NP_057334Gene Name
NDRG2
Gene Alias
DKFZp781G1938, FLJ25522, KIAA1248, SYLD
Gene Description
NDRG family member 2
Omim ID
605272Gene Ontology
HyperlinkGene Summary
This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
N-myc downstream regulator 2|N-myc downstream-regulated gene 2|NDR1-related protein NDR2|OTTHUMP00000164407|cytoplasmic protein Ndr1|syld709613 protein
-
Interactome
-
Publication Reference
-
Colorectal Cancer Cell Differentiation Is Dependent on the Repression of Aerobic Glycolysis by NDRG2-TXNIP Axis.
Junbi Hu, Lin Feng, Mudan Ren, Yan Zhao, Guifang Lu, Xinlan Lu, Yarui Li, Xin Wang, Xin Bu, Shuai Wang, Liangliang Shen, Shuixiang He.
Digestive Diseases and Sciences 2022 Aug; 67(8):3763.
Application:IF, IHC-P, WB-Tr, Human, Mouse, Caco-2, HT-29 cells Human colon tissues, Human colorectal cancers, Mouse intestinal epithelium.
-
NDRG2 ablation reprograms metastatic cancer cells towards glutamine dependence via the induction of ASCT2.
Mingchao Ding, Xin Bu, Zhehao Li, Haokun Xu, Lin Feng, Junbi Hu, Xinxin Wei, Jiwei Gao, Yanyan Tao, Bolei Cai, Yanpu Liu, Xuan Qu, Liangliang Shen.
International Journal of Biological Sciences 2020 Oct; 16(16):3100.
Application:IHC, WB-Ce, WB-Tr, Human, Human mucoepidermoid carcinoma, MC3, MEC1 cells.
-
Spatiotemporal expression of NDRG2 in the human fetal brain.
Jin PP, Xia F, Ma BF, Li Z, Zhang GF, Deng YC, Tu ZL, Zhang XX, Hou SX.
Annals of Anatomy 2019 Jan; 221:148.
Application:IF, IHC-P, Human, Human fetal brain.
-
NDRG2 facilitates colorectal cancer differentiation through the regulation of Skp2-p21/p27 axis.
Shen L, Qu X, Li H, Xu C, Wei M, Wang Q, Ru Y, Liu B, Xu Y, Li K, Hu J, Wang L, Ma Y, Li M, Lai X, Gao L, Wu K, Yao L, Zheng J, Zhang J.
Oncogene 2018 Mar; 37(13):1759.
Application:IF, IHC, WB, Human, Mouse, Human colorectal cancer, Mouse intestinal epithelium, HCT-116, HT-29 cells.
-
N-myc downstream-regulated gene 2 expression is associated with glucose transport and correlated with prognosis in breast carcinoma.
Ma J, Liu W, Guo H, Li S, Cao W, Du X, Lei S, Hou W, Xiong L, Yao L, Li N, Li Y.
Breast Cancer Research 2014 Mar; 16(2):R27.
Application:IF, IHC, WB-Ce, WB-Ti, WB-Tr, Human, Breast carcinoma, T-47D, MCF-7, Bcap37, MDA-MB-231, SK-BR-3 cells.
-
Tumor suppressor NDRG2 tips the balance of oncogenic TGF-β via EMT inhibition in colorectal cancer.
Shen L, Qu X, Ma Y, Zheng J, Chu D, Liu B, Li X, Wang M, Xu C, Liu N, Yao L, Zhang J.
Oncogenesis 2014 Feb; 3:e86.
Application:WB-Ce, WB-Tr, Human, HaCaT, HIEC, Caco-2, Colo205, HT29, HCT116, SW480, SW620 cells.
-
Regulation of N-Myc downstream regulated gene 2 by bile acids.
Langhi C, Pedraz-Cuesta E, Donate Y, Marrero PF, Haro D, Rodriguez JC.
Biochemical and Biophysical Research Communications 2013 Apr; 434(1):102.
Application:WB-Ce, WB-Ti, Human, Mouse, Huh7 cells, Liver, Kidney.
-
NDRG2: a newly identified mediator of insulin cardioprotection against myocardial ischemia-reperfusion injury.
Sun Z, Tong G, Ma N, Li J, Li X, Li S, Zhou J, Xiong L, Cao F, Yao L, Wang H, Shen L.
Basic Research in Cardiology 2013 Mar; 108(3):341.
Application:WB, IHC-P, Rat, Rat myocardial tissues.
-
NDRG2 Is a Novel p53-Associated Regulator of Apoptosis in C6-Originated Astrocytes Exposed to Oxygen-Glucose Deprivation.
Li Y, Xu N, Cai L, Gao Z, Shen L, Zhang Q, Hou W, Zhong H, Wang Q, Xiong L.
PLoS One 2013 Feb; 8(2):e57130.
Application:IFA,WB, Rat, C6 cells.
-
NDRG2 correlated with favorable recurrence-free survival inhibits metastasis of mouse breast cancer cells via attenuation of active TGF-β production.
Oh SS, Kim D, Kim DH, Chang HH, Sohn KC, Kim KH, Jung SH, Lee BK, Kim JH, Kim KD.
Carcinogenesis 2012 Oct; 33(10):1882.
Application:IHC-P, Human, Human breast cancer.
-
Microarray profiling of HepG2 cells ectopically expressing NDRG2.
Liu X, Niu T, Liu X, Hou W, Zhang J, Yao L.
Gene 2012 Jul; 503(1):48.
Application:WB-Ce, Human, Hep-G2, HHCC cells.
-
NDRG2 down-regulation and CD24 up-regulation promote tumor aggravation and poor survival in patients with gallbladder carcinoma.
Song SP, Zhang SB, Liu R, Yao L, Hao YQ, Liao MM, Zhang YD, Li ZH.
Medical Oncology 2012 Sep; 29(3):1879.
Application:IHC-P, Human, Gallbladder carcinoma.
-
Up-regulation of NDRG2 through nuclear factor-kappa B is required for Leydig cell apoptosis in both human and murine infertile testes.
Li T, Hu J, He GH, Li Y, Zhu CC, Hou WH, Zhang S, Li W, Zhang JS, Wang Z, Liu XP, Yao LB, Zhang YQ.
Biochimica et Biophysica Acta 2012 Feb; 1822(2):301.
Application:IF, IHC, WB-Ce, WB-Tr, Mouse, Rat, TM3 cells, Testes.
-
NDRG2 Ameliorates Hepatic Fibrosis by Inhibiting the TGF-beta 1/Smad Pathway and Altering the MMP2/TIMP2 Ratio in Rats.
Yang J, Zheng J, Wu L, Shi M, Zhang H, Wang X, Xia N, Wang D, Liu X, Yao L, Li Y, Dou K.
PLoS One 2011 Nov; 6(11):e27710.
Application:IHC-P, IF, WB-Ce, WB-Tr, Human, Rat, LX-2 cells, Liver.
-
Regulation of histone acetylation by NDRG2 in glioma cells.
Li L, Qin X, Shi M, Miao R, Wang L, Liu X, Yao L, Deng Y.
Journal of Neuro-Oncology 2012 Feb; 106(3):485.
Application:WB-Ce, Human, U251, U87 MG cells.
-
NDRG2 inhibits hepatocellular carcinoma adhesion, migration and invasion by regulating CD24 expression.
Zheng J, Li Y, Yang J, Liu Q, Shi M, Zhang R, Shi H, Ren Q, Ma J, Guo H, Tao Y, Xue Y, Jiang N, Yao L, Liu W.
BMC Cancer 2011 Jun; 11:251.
Application:WB-Ce, WB-Ti, WB-Tr, Human, MHCC97H, Huh7, L-02 cells, Liver.
-
Spatial-temporal expression of NDRG2 in rat brain after focal cerebral ischemia and reperfusion.
Li Y, Shen L, Cai L, Wang Q, Hou W, Wang F, Zeng Y, Zhao G, Yao L, Xiong L.
Brain Research 2011 Mar; 1382:252.
Application:WB, Rat, Ischemic penumbra.
-
Variation of NDRG2 and c-Myc expression in rat heart during the acute stage of ischemia/reperfusion injury.
Sun Z, Shen L, Sun X, Tong G, Sun D, Han T, Yang G, Zhang J, Cao F, Yao L, Wang H.
Histochemistry and Cell Biology 2011 Jan; 135(1):27.
Application:WB, Rat, Heart.
-
NDRG2 is highly expressed in pancreatic beta cells and involved in protection against lipotoxicity.
Shen L, Liu X, Hou W, Yang G, Wu Y, Zhang R, Li X, Che H, Lu Z, Zhang Y, Liu X, Yao L.
Cellular and Molecular Life Sciences 2010 Apr; 67(8):1371.
Application:IF, IHC-P, WB, Mouse, Rat, INS-1, beta-TC3, and beta-TC6 cells, Pancreatic islets.
-
Immunohistochemical detection of Ndrg2 in the mouse nervous system.
Shen L, Zhao ZY, Wang YZ, Ji SP, Liu XP, Liu XW, Che HL, Lin W, Li X, Zhang J, Yao LB.
Neuroreport 2008 Jun; 19(9):927.
Application:IF, IHC-P, WB, Mouse, Rat, C6 cells, Mouse brain.
-
Colorectal Cancer Cell Differentiation Is Dependent on the Repression of Aerobic Glycolysis by NDRG2-TXNIP Axis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com