NDRG2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant NDRG2.
Immunogen
NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
Sequence
MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.67 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — NDRG2
Entrez GeneID
57447GeneBank Accession#
NM_016250Protein Accession#
NP_057334Gene Name
NDRG2
Gene Alias
DKFZp781G1938, FLJ25522, KIAA1248, SYLD
Gene Description
NDRG family member 2
Omim ID
605272Gene Ontology
HyperlinkGene Summary
This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
N-myc downstream regulator 2|N-myc downstream-regulated gene 2|NDR1-related protein NDR2|OTTHUMP00000164407|cytoplasmic protein Ndr1|syld709613 protein
-
Interactome
-
Publication Reference
-
NDRG2 as a marker protein for brain astrocytes.
Flugge G, Araya-Callis C, Garea-Rodriguez E, Stadelmann-Nessler C, Fuchs E.
Cell and Tissue Research 2014 Jul; 357(1):31.
Application:IHC, IF, Human, Mouse, Monkey, Rat, Brain.
-
Chronic psychosocial stress and citalopram modulate the expression of the glial proteins GFAP and NDRG2 in the hippocampus.
Araya-Callís C, Hiemke C, Abumaria N, Flugge G.
Psychopharmacology 2012 Nov; 224(1):209.
Application:IF, IHC, Rat, Rat hippocampus.
-
NDRG2 as a marker protein for brain astrocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com