SCYL1 monoclonal antibody (M02), clone 2E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in human ovarian cancer.
Western Blot (Cell lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in PC-12.
Western Blot (Cell lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in A-431.
Western Blot (Cell lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in NIH/3T3.
Western Blot (Cell lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in Hela S3 NE ( Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SCYL1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SCYL1.
Immunogen
SCYL1 (AAH09967, 373 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in human ovarian cancer.Western Blot (Cell lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in PC-12.Western Blot (Cell lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in A-431.Western Blot (Cell lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in NIH/3T3.Western Blot (Cell lysate)
SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SCYL1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SCYL1
Entrez GeneID
57410GeneBank Accession#
BC009967Protein Accession#
AAH09967Gene Name
SCYL1
Gene Alias
GKLP, HT019, MGC78454, NKTL, NTKL, P105, TAPK, TEIF, TRAP
Gene Description
SCY1-like 1 (S. cerevisiae)
Omim ID
607982Gene Ontology
HyperlinkGene Summary
This gene encodes a transcriptional regulator belonging to the SCY1-like family of kinase-like proteins. The protein has a divergent N-terminal kinase domain that is thought to be catalytically inactive, and can bind specific DNA sequences through its C-terminal domain. It activates transcription of the telomerase reverse transcriptase and DNA polymerase beta genes. The protein has been localized to the nucleus, and also to the cytoplasm and centrosomes during mitosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
N-terminal kinase-like protein|SCY1-like 1|likely ortholog of mouse N-terminal kinase-like protein|telomerase regulation-associated protein|telomerase transcriptional elements-interacting factor|teratoma-associated tyrosine kinase
-
Interactome
-
Publication Reference
-
Identification of Tyrosine-Phosphorylated Proteins Associated with Lung Cancer Metastasis using Label-Free Quantitative Analyses.
Wu HY, Tseng VS, Chen LC, Chang HY, Chuang IC, Tsay YG, Liao PC.
Journal of Proteome Research 2010 Aug; 9(8):4102.
Application：WB-Ce, Human, CL1-0, CL1-5 cells.
-
Identification of Tyrosine-Phosphorylated Proteins Associated with Lung Cancer Metastasis using Label-Free Quantitative Analyses.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com