Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAB22A purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00057403-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RAB22A protein.
  • Immunogen:
  • RAB22A (AAH15710.1, 1 a.a. ~ 194 a.a) full-length human protein.
  • Sequence:
  • MALRELRVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRRHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RAB22A expression in transfected 293T cell line (H00057403-T01) by RAB22A MaxPab polyclonal antibody.

    Lane 1: RAB22A transfected lysate(21.45 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • RAB22A
  • Gene Alias:
  • MGC16770
  • Gene Description:
  • RAB22A, member RAS oncogene family
  • Gene Summary:
  • The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq
  • Other Designations:
  • GTP-binding protein RAB22A,OTTHUMP00000031397,RAS-related protein RAB-22A
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook