RHOJ monoclonal antibody (M01), clone 1E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RHOJ.
Immunogen
RHOJ (AAH62575, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Isotype
IgG1 lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (49.28 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RHOJ is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RHOJ on HeLa cell. [antibody concentration 60 ug/ml] -
Gene Info — RHOJ
Entrez GeneID
57381GeneBank Accession#
BC062575Protein Accession#
AAH62575Gene Name
RHOJ
Gene Alias
ARHJ, FLJ14445, MGC34777, RASL7B, TC10B, TCL
Gene Description
ras homolog gene family, member J
Omim ID
607653Gene Ontology
HyperlinkGene Summary
ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.[supplied by OMIM
Other Designations
RAS-like, family 7, member B|TC10-like Rho GTPase
-
Interactome
-
Disease
-
Publication Reference
-
Towards Understanding the Development of Breast Cancer: The Role of RhoJ in the Obesity Microenvironment.
Lara J Bou Malhab, Vidhya A Nair, Rizwan Qaisar, Gianfranco Pintus, Wael M Abdel-Rahman.
Cells 2024 Jan; 13(2):174.
Application:WB, Mice, wild-type c57BL/6j mice mammary glands.
-
Structure-based design of CDC42 effector interaction inhibitors for the treatment of cancer.
Sohail Jahid, Jose A Ortega, Linh M Vuong, Isabella Maria Acquistapace, Stephanie J Hachey, Jessica L Flesher, Maria Antonietta La Serra, Nicoletta Brindani, Giuseppina La Sala, Jacopo Manigrasso, Jose M Arencibia, Sine Mandrup Bertozzi, Maria Summa, Rosalia Bertorelli, Andrea Armirotti, Rongsheng Jin, Zheng Liu, Chi-Fen Chen, Robert Edwards, Christopher C W Hughes, Marco De Vivo, Anand K Ganesan.
Cell Reports 2022 Apr; 39(1):110641.
Application:Pull-Down, Human, WM3248 cells.
-
RhoJ facilitates angiogenesis in glioblastoma via JNK/VEGFR2 mediated activation of PAK and ERK signaling pathways.
Mei Wang, Chengfei Zhang, Qian Zheng, Zhijie Ma, Min Qi, Guangfu Di, Shizhang Ling, Haojun Xu, Bin Qi, Chengyun Yao, Hongping Xia, Xiaochun Jiang.
International Journal of Biological Sciences 2022 Jan; 18(3):942.
Application:IHC-P, WB-Ce, WB-Tr, Human, Mouse, Human brain, U87 MG cells, mouse xenograft tumor tissues.
-
RhoJ Regulates α5β1 Integrin Trafficking to Control Fibronectin Remodeling during Angiogenesis.
Sundararaman A, Fukushima Y, Norman JC, Uemura A, Mellor H.
Current Biology 2020 Jun; 30(11):2146.
Application:WB-Tr, Human, Endothelial cells.
-
Anti-RhoJ antibody functionalized Au@I nanoparticles as CT-guided tumor vessel-targeting radiosensitizers in patient-derived tumor xenograft model.
Liu S, Li H, Xia L, Xu P, Ding Y, Huo D, Hu Y.
Biomaterials 2017 Jun; 141:1.
Application:Func, Nanoparticles.
-
Rho GTPase RhoJ is Associated with Gastric Cancer Progression and Metastasis.
Kim C, Yang H, Park I, Chon HJ, Kim JH, Kwon WS, Lee WS, Kim TS, Rha SY.
Journal of Cancer 2016 Jul; 7(11):1550.
Application:IHC, WB-Ce, WB-Tr, Human, YCC-1, YCC-2, YCC-3, YCC-7, YCC-9, YCC-10,YCC-11, YCC-16, HUVEC cells, Gastric cancer.
-
RhoJ regulates melanoma chemoresistance by suppressing pathways that sense DNA damage.
Ho H, Aruri J, Kapadia R, Mehr H, White MA, Ganesan AK.
Cancer Research 2012 Nov; 72(21):5516.
Application:WB-Tr, Human, C8161, SKM28, MNT-1 cells.
-
Sema3E-PlexinD1 signaling selectively suppresses disoriented angiogenesis in ischemic retinopathy in mice.
Fukushima Y, Okada M, Kataoka H, Hirashima M, Yoshida Y, Mann F, Gomi F, Nishida K, Nishikawa S, Uemura A.
J Clin Invest 2011 Apr; 121:1974.
Application:IF, Human, HUVECs.
-
Towards Understanding the Development of Breast Cancer: The Role of RhoJ in the Obesity Microenvironment.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com