Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CX36 (Human) Recombinant Protein (Q01)

  • Catalog # : H00057369-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CX36 partial ORF ( NP_065711.1, 99 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00057369-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • GJD2
  • Gene Alias:
  • CX36,GJA9,MGC138315,MGC138319
  • Gene Description:
  • gap junction protein, delta 2, 36kDa
  • Gene Summary:
  • This gene is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons. [provided by RefSeq
  • Other Designations:
  • connexin 36,connexin-36,gap junction alpha-9 protein,gap junction protein, alpha 9, 36kDa
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook