ZNF287 monoclonal antibody (M12), clone 1A2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZNF287 expression in transfected 293T cell line by ZNF287 monoclonal antibody (M12), clone 1A2.
Lane 1: ZNF287 transfected lysate (Predicted MW: 87.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF287 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZNF287.
Immunogen
ZNF287 (NP_065704.1, 231 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PEWETKAQACTPVEDMSKLTKEETHTIKLEDSYDYDDRLERRGKGGFWKIHTDERGFSLKSVLSQEYDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (86)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZNF287 expression in transfected 293T cell line by ZNF287 monoclonal antibody (M12), clone 1A2.
Lane 1: ZNF287 transfected lysate (Predicted MW: 87.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF287 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — ZNF287
Entrez GeneID
57336GeneBank Accession#
NM_020653Protein Accession#
NP_065704.1Gene Name
ZNF287
Gene Alias
MGC126536, MGC141923, ZKSCAN13
Gene Description
zinc finger protein 287
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the krueppel family of zinc finger proteins, suggesting a role as a transcription factor. Its specific function has not been determined. This gene is located near the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com