KIAA1199 monoclonal antibody (M01), clone 3C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of KIAA1199 expression in transfected 293T cell line by KIAA1199 monoclonal antibody (M01), clone 3C12.
Lane 1: KIAA1199 transfected lysate(110.4 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of KIAA1199 transfected lysate using anti-KIAA1199 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KIAA1199 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KIAA1199 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KIAA1199.
Immunogen
KIAA1199 (NP_061159.1, 880 a.a. ~ 979 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KIAA1199 expression in transfected 293T cell line by KIAA1199 monoclonal antibody (M01), clone 3C12.
Lane 1: KIAA1199 transfected lysate(110.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of KIAA1199 transfected lysate using anti-KIAA1199 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KIAA1199 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KIAA1199 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — KIAA1199
Entrez GeneID
57214GeneBank Accession#
NM_018689Protein Accession#
NP_061159.1Gene Name
KIAA1199
Gene Alias
TMEM2L
Gene Description
KIAA1199
Omim ID
608366Gene Ontology
HyperlinkOther Designations
OTTHUMP00000185569|OTTHUMP00000195036|transmembrane protein 2-like
-
Interactome
-
Disease
-
Publication Reference
-
Secreted KIAA1199 promotes the progression of rheumatoid arthritis by mediating hyaluronic acid degradation in an ANXA1-dependent manner.
Wei Zhang, Guoyu Yin, Heping Zhao, Hanzhi Ling, Zhen Xie, Chipeng Xiao, Yan Chen, Yufan Lin, Tao Jiang, Shengwei Jin, Jianguang Wang, Xinyu Yang.
Cell Death & Disease 2021 Jan; 12(1):102.
Application：IP, Human, Human rheumatoid arthritis fibroblast-like synoviosytes.
-
The miR-29c-KIAA1199 axis regulates gastric cancer migration by binding with WBP11 and PTP4A3.
Wang L, Yu T, Li W, Li M, Zuo Q, Zou Q, Xiao B.
Oncogene 2019 Jan; [Epub].
Application：IP, WB-Tr, Human, AGS, BGC-823, SGC-7901, GC cells.
-
KIAA1199 as a potential diagnostic biomarker of rheumatoid arthritis related to angiogenesis.
Yang X, Qiu PC, Chen BB, Lin YY, Zhou ZH, Ge RS, Zou H, Wang JM, Wang JG.
Arthritis Research & Therapy 2015 May; 17:140.
Application：WB-Tr, Human, FLS cells .
-
Secreted KIAA1199 promotes the progression of rheumatoid arthritis by mediating hyaluronic acid degradation in an ANXA1-dependent manner.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com