SLC39A10 monoclonal antibody (M03), clone 1F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SLC39A10 expression in transfected 293T cell line by SLC39A10 monoclonal antibody (M03), clone 1F6.
Lane 1: SLC39A10 transfected lysate (Predicted MW: 94.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC39A10 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC39A10.
Immunogen
SLC39A10 (NP_065075, 514 a.a. ~ 621 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIHEHDL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SLC39A10 expression in transfected 293T cell line by SLC39A10 monoclonal antibody (M03), clone 1F6.
Lane 1: SLC39A10 transfected lysate (Predicted MW: 94.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC39A10 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SLC39A10
Entrez GeneID
57181GeneBank Accession#
NM_020342Protein Accession#
NP_065075Gene Name
SLC39A10
Gene Alias
DKFZp781L10106, LZT-Hs2, MGC126565, MGC138428
Gene Description
solute carrier family 39 (zinc transporter), member 10
Omim ID
608733Gene Ontology
HyperlinkGene Summary
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).[supplied by OMIM
Other Designations
solute carrier family 39 (metal ion transporter), member 10
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com