SALL4 monoclonal antibody (M03), clone 6E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SALL4.
Immunogen
SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (71); Rat (71)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SALL4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SALL4 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — SALL4
Entrez GeneID
57167GeneBank Accession#
NM_020436Protein Accession#
NP_065169Gene Name
SALL4
Gene Alias
DRRS, HSAL4, MGC133050, ZNF797, dJ1112F19.1
Gene Description
sal-like 4 (Drosophila)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). [provided by RefSeq
Other Designations
OTTHUMP00000031296|sal-like 4
-
Interactome
-
Disease
-
Publication Reference
-
Rattus norvegicus Spermatogenesis Colony-Forming Assays.
Karen M Chapman, Ashutosh Pudasaini, Morgan N Vanderbeck, F Kent Hamra .
Methods in Molecular Biology (Clifton, N.J.) 2023 Jul; 2677:233.
Application:IF, Rat, Rat spermatogonial lines.
-
Establishment and characterization of NCC-MRT1-C1: a novel cell line of malignant rhabdoid tumor.
Taro Akiyama, Yuki Yoshimatsu, Rei Noguchi, Yooksil Sin, Ryuto Tsuchiya, Takuya Ono, Chiaki Sato, Naoki Kojima, Akihiko Yoshida, Akira Kawai, Seji Ohtori, Tadashi Kondo.
Human Cell 2022 Nov; 35(6):2002.
Application:IHC, Human, Human tumor tissue.
-
The first case of SMARCA4-deficient sarcoma of stomach.
Takayuki Ota, Takeshi Ishikawa, Ritsu Yasuda, Tomoyo Yasuda, Tetsuya Okayama, Ken Inoue, Osamu Dohi, Naohisa Yoshida, Kazuhiro Kamada, Kazuhiko Uchiyama, Tomohiro Takagi, Hideyuki Konishi, Yuji Naito, Kiichi Matsuyama, Tomohiro Yamaguchi, Kazuo Ootsuka, Akihiko Yoshida, Mitsuo Kishimoto, Yoshito Itoh.
Clinical Journal of Gastroenterology 2022 Jun; 15(3):531.
Application:IHC-P, Human, Human stomach.
-
Distinct properties of pure- and mixed-type high-grade fetal lung adenocarcinomas by genetic profiling and transcription factor expression.
Satsuki Kishikawa, Takuo Hayashi, Tsuyoshi Saito, Kazuya Takamochi, Keita Sasa, Yoshiyuki Suehara, Fumiyuki Takahashi, Noriko Sasahara, Shinji Kohsaka, Kenji Suzuki, Takashi Yao.
Virchows Archiv : an International Journal of Pathology 2022 Mar; 480(3):609.
Application:IHC-P, Human, Human lung adenocarcinoma.
-
Neonatal streptozotocin treatment rapidly causes different subtype of hepatocellular carcinoma without persistent hyperglycemia in 4CS mice fed on a normal diet.
Tomoko Kobayashi, Mayuko Ichimura-Shimizu, Takeshi Oya, Hirohisa Ogawa, Minoru Matsumoto, Yuki Morimoto, Satoshi Sumida, Takumi Kakimoto, Michiko Yamashita, Mitsuko Sutoh, Shunji Toyohara, Ryoji Hokao, Chunmei Cheng, Koichi Tsuneyama.
Pathology, Research and Practice 2021 Sep; 225:153559.
Application:IHC-P, Mouse, Mouse liver tumor, Mouse GS-patchy tumor.
-
Atezolizumab with bevacizumab, paclitaxel and carboplatin was effective for patients with SMARCA4-deficient thoracic sarcoma.
Hayato Kawachi, Kei Kunimasa, Yoji Kukita, Harumi Nakamura, Keiichiro Honma, Takahisa Kawamura, Takako Inoue, Motohiro Tamiya, Hanako Kuhara, Kazumi Nishino, Yu Mizote, Takashi Akazawa, Hideaki Tahara, Toru Kumagai.
Immunotherapy 2021 Jul; 13(10):799.
Application:IHC-P, Human, Human thoracic sarcoma.
-
Early gastric cancer involving a pure enteroblastic differentiation component that was curatively resected via endoscopic submucosal dissection.
Nobuaki Ikezawa, Shinwa Tanaka, Hidetoshi Kaku, Toshitatsu Takao, Yoshinori Morita, Takashi Toyonaga, Masato Komatsu, Hiroshi Yokozaki, Tomoo Ito, Yuzo Kodama.
Clinical Journal of Gastroenterology 2020 Aug; 13(4):512.
Application:IHC, Human, Gastric adenocarcinoma.
-
A yolk sac tumor of the pancreas and derived xenograft model effectively responded to VIP chemotherapy.
Junpei Yonemaru, Mami Takahashi, Satoshi Nara, Hitoshi Ichikawa, Rikako Ishigamori, Toshio Imai, Nobuyoshi Hiraoka.
Pancreatology 2020 Apr; 20(3):551.
Application:IHC-P, Human, Human yolk sac tumor of the pancreas.
-
Inflammatory Micro-environment Contributes to Stemness Properties and Metastatic Potential of HCC via the NF-κB/miR-497/SALL4 Axis.
Zhao B, Wang Y, Tan X, Ke K, Zheng X, Wang F, Lan S, Liao N, Cai Z, Shi Y, Zheng Y, Lai Y, Wang L, Li Q, Liu J, Huang A, Liu X.
Molecular Therapy Oncolytics 2019 Sep; 15:79.
Application:WB, Human, Hep3B, HepG2 cells.
-
Ku80 negatively regulates the expression of OCT4 via competitive binding to SALL4 and promoting lysosomal degradation of OCT4.
Zhao B, Zheng X, Tan X, Ke K, Wang F, Wang Y, Xing X, Zhang C, Hu P, Lan S, Li Q, Huang A, Liu X.
The International Journal of Biochemistry & Cell Biology 2019 Dec; 118:105664.
Application:IF, IP, WB, Human, 293T, Huh7 cells.
-
A case of renal cell carcinoma unclassified with medullary phenotype without detectable gene deletion.
Tsuzuki S, Kataoka TR, Ito H, Ueshima C, Asai S, Yokoo H, Haga H.
Pathology International 2019 Dec; 69(12):710.
Application:IHC, Human, Human renal cell carcinoma.
-
Colorectal adenocarcinoma with enteroblastic differentiation: A clinicopathological study of five cases.
Murakami T, Yao T, Yatagai N, Yamashiro Y, Saito T, Sakamoto N, Nagahara A.
Histopathology 2019 Aug; [Epub].
Application:IHC-P, Human, Human colorectal adenocarcinoma.
-
A case of large cell neuroendocrine carcinoma exhibiting rhabdoid features in the esophagogastric junction.
Ichimata S, Aoyagi D, Takehana T, Uehara T, Shiozawa S.
Pathology International 2019 Aug; 69(8):481.
Application:IHC, Human, Human large cell neuroendocrine carcinoma.
-
Human Pluripotent Stem Cell-Derived Tumor Model Uncovers the Embryonic Stem Cell Signature as a Key Driver in Atypical Teratoid/Rhabdoid Tumor.
Terada Y, Jo N, Arakawa Y, Sakakura M, Yamada Y, Ukai T, Kabata M, Mitsunaga K, Mineharu Y, Ohta S, Nakagawa M, Miyamoto S, Yamamoto T, Yamada Y.
Cell Reports 2019 Mar; 26(10):2608.
Application:IHC-P, Mouse, Mouse tumors.
-
Early Gastric Cancer with Purely Enteroblastic Differentiation and No Conventional Adenocarcinoma Component.
Yamada R, Horiguchi SI, Onishi T, Motoi T, Hishima T.
Case Reports in Pathology 2018 Aug; 2018:3620293.
Application:IHC, Human, Human gastric cancer.
-
HER2 is frequently overexpressed in hepatoid adenocarcinoma and gastric carcinoma with enteroblastic differentiation: a comparison of 35 cases to 334 gastric carcinomas of other histological types.
Fujimoto M, Matsuzaki I, Nishino M, Iwahashi Y, Warigaya K, Kojima F, Ono K, Murata SI.
Journal of Clinical Pathology 2018 Jan; [Epub].
Application:IHC-P, Human, Human gastric carcinomas with enteroblastic differentiation, Human hepatoid adenocarcinoma.
-
Review with novel markers facilitates precise categorization of 41 cases of diagnostically challenging, "undifferentiated small round cell tumors". A clinicopathologic, immunophenotypic and molecular analysis.
Machado I, Yoshida A, Morales MGN, Abrahão-Machado LF, Navarro S, Cruz J, Lavernia J, Parafioriti A, Picci P, Llombart-Bosch A.
Annals of Diagnostic Pathology 2018 Jun; 34:1.
Application:IHC-P, Human, Sarcoma.
-
3,3'-Diindolylmethane stimulates exosomal Wnt11 autocrine signaling in human umbilical cord mesenchymal stem cells to enhance wound healing.
Shi H, Xu X, Zhang B, Xu J, Pan Z, Gong A, Zhang X, Li R, Sun Y, Yan Y, Mao F, Qian H, Xu W.
Theranostics 2017 Apr; 7(6):1674.
Application:WB-Ce, Human, Human umbilical cord-derived mesenchymal stem cells.
-
Germinoma with an extensive rhabdoid cell component centered at the corpus callosum.
Tajima S, Koda K.
Medical Molecular Morphology 2017 Mar; 50(1):52.
Application:IHC-P, Human, Human central nervous system (CNS) germ cell tumors.
-
Clinicopathological and molecular characterization of SMARCA4-deficient thoracic sarcomas with comparison to potentially related entities.
Yoshida A, Kobayashi E, Kubo T, Kodaira M, Motoi T, Motoi N, Yonemori K, Ohe Y, Watanabe SI, Kawai A, Kohno T, Kishimoto H, Ichikawa H, Hiraoka N.
Modern Pathology 2017 Mar; 30(6):797.
Application:IHC-P, Human, Human thoracic sarcomas.
-
Clinicopathological features of alpha-fetoprotein producing early gastric cancer with enteroblastic differentiation.
Matsumoto K, Ueyama H, Matsumoto K, Akazawa Y, Komori H, Takeda T, Murakami T, Asaoka D, Hojo M, Tomita N, Nagahara A, Kajiyama Y, Yao T, Watanabe S.
World Journal of Gastroenterology 2016 Sep; 22(36):8203.
Application:IHC, Human, Gastric cancer.
-
The zinc-finger transcription factor SALL4 is frequently expressed in human cancers: association with clinical outcome in squamous cell carcinoma but not in adenocarcinoma of the esophagus.
Kilic E, Tennstedt P, Högner A, Lebok P, Sauter G, Bokemeyer C, Izbicki JR, Wilczak W.
Amino Acids 2016 Jan; 468(4):483.
Application:IHC-P, Human, Human esophagus cancer, Human multitumor tissue microarray (TMA).
-
NRG1 and KITL signal downstream of retinoic acid in the germline to support soma-free syncytial growth of differentiating spermatogonia.
Chapman KM, Medrano GA, Chaudhary J, Hamra FK.
Cell Death Discovery 2015 Oct; 1:15018.
Application:IF, Rat, Testis.
-
Clinicopathologic and immunohistochemical characteristics of gastric adenocarcinoma with enteroblastic differentiation: a study of 29 cases.
Murakami T, Yao T, Mitomi H, Morimoto T, Ueyama H, Matsumoto K, Saito T, Osada T, Nagahara A, Watanabe S.
Gastric Cancer 2016 Apr; 19(2):498.
Application:IHC-P, Human, Gastric adenocarcinoma.
-
Clinicopathologic characteristics of SALL4-immunopositive hepatocellular carcinoma.
Shibahara J, Ando S, Hayashi A, Sakamoto Y, Hesegawa K, Kokudo N, Fukayama M.
SpringerPlus 2014 Dec; 3:271.
Application:IHC-P, Human, Hepatocellular carcinomas.
-
ERG and SALL4 expressions in SMARCB1/INI1-deficient tumors: a useful tool for distinguishing epithelioid sarcoma from malignant rhabdoid tumor.
Kohashi K, Yamada Y, Hotokebuchi Y, Yamamoto H, Taguchi T, Iwamoto Y, Oda Y.
Human Pathology 2015 Feb; 46(2):225.
Application:IHC-P, Human, Epithelioid sarcomas, Malignant rhabdoid tumors.
-
Differential SALL4 Immunoexpression in Malignant Rhabdoid Tumours and Epithelioid Sarcomas.
Yoshida A, Asano N, Kawai A, Kawamoto H, Nakazawa A, Kishimoto H, Kushima R.
Histopathology 2015 Jan; 66(2):252.
Application:IHC-P, Human, Epithelioid sarcomas, Malignant rhabdoid tumors.
-
Combination of hepatocellular markers is useful for prognostication in gastric hepatoid adenocarcinoma.
Osada M, Aishima S, Hirahashi M, Takizawa N, Takahashi S, Nakamura K, Tanaka M, Maehara Y, Takayanagi R, Oda Y.
Human Pathology 2014 Jun; 45(6):1243.
Application:IHC, Human, Hepatoid Adenocarcinoma.
-
SALL4 immunohistochemistry in non-small cell lung carcinomas.
Fujimoto M, Sumiyoshi S, Yoshizawa A, Sonobe M, Kobayashi M, Moriyoshi K, Kido A, Tanaka C, Koyanagi I, Date H, Haga H.
Histopathology 2014 Jan; 64(2):309.
Application:IHC, Human, Human non-small cell lung carcinomas.
-
The Transcription Factor SALL4 Regulates Stemness of EpCAM-positive Hepatocellular Carcinoma.
Sha Zeng S, Yamashita T, Kondo M, Nio K, Hayashi T, Hara Y, Nomura Y, Yoshida M, Hayashi T, Oishi N, Ikeda H, Honda M, Kaneko S.
Journal of Hepatology 2014 Jan; 60(1):127.
Application:WB, IHC, Human, HCC (IHC), HCC cell lines (WB).
-
Metastatic seminomas in lymph nodes: CD10 immunoreactivity can be a pitfall of differential diagnosis.
Ota Y, Iihara K, Ryu T, Morikawa T, Fukayama M.
International Journal Of Experimental Pathology 2013 Feb; 6(3):498.
Application:IHC, Human, Human seminoma.
-
α-Fetoprotein-producing gastric carcinoma and combined hepatocellular and cholangiocarcinoma show similar morphology but different histogenesis with respect to SALL4 expression.
Ikeda H, Sato Y, Yoneda N, Harada K, Sasaki M, Kitamura S, Sudo Y, Ooi A, Nakanuma Y.
Human Pathology 2012 Nov; 43(11):1955.
Application:IHC, Human, Human fetal livers.
-
Mediastinal seminoma: a case report with special emphasis on SALL4 as a new immunocytochemical marker.
Iwamoto N, Ishida M, Yoshida K, Kagotani A, Iwai M, Okabe H.
Diagnostic Cytopathology 2013 Sep; 41(9):821.
Application:IHC-P, Human, Cystic fluid of the anterior mediastinal tumor.
-
alpha-Fetoprotein-producing ovarian tumor in a postmenopausal woman with germ cell differentiation.
Meguro S, Yasuda M.
Annals of Diagnostic Pathology 2013 Feb; 17(1):140.
Application:IHC, Human, Ovarian tumor.
-
Beta-Catenin and K-RAS Synergize to Form Primitive Renal Epithelial Tumors with Features of Epithelial Wilms' Tumors.
Clark PE, Polosukhina D, Love H, Correa H, Coffin C, Perlman EJ, de Caestecker M, Moses HL, Zent R.
The American Journal of Pathology 2011 Dec; 179(6):3045.
Application:IHC-P, Human, Epithelial Wilms' tumors.
-
Immunoexpression of SALL4 in Wilms Tumors and Developing Kidney.
Deisch J, Raisanen J, Rakheja D.
Pathology Oncology Research 2011 Sep; 17(3):639.
Application:IHC, Human, Kidney.
-
Specificity of brachyury in the distinction of chordoma from clear cell renal cell carcinoma and germ cell tumors: a study of 305 cases.
Sangoi AR, Karamchandani J, Lane B, Higgins JP, Rouse RV, Brooks JD, McKenney JK.
Modern Pathology 2011 Mar; 24(3):425.
Application:IHC, Human, Germ cell tumors, Renal cell carcinoma, Chordomas.
-
Expression Pattern of Stemness-Related Genes in Human Endometrial and Endometriotic Tissues.
Forte A, Schettino MT, Finicelli M, Cipollaro M, Colacurci N, Cobellis L, Galderisi U.
Molecular Medicine 2009 Nov; 15(11-12):392.
Application:IHC-P, Human, Mouse, Human endometrial tissues, Mouse heart, Mouse testis, .
-
Markers that define stemness in ESC are unable to identify the totipotent cells in human preimplantation embryos.
Cauffman G, De Rycke M, Sermon K, Liebaers I, Van de Velde H.
Human Reproduction 2008 Sep; 24(1):63.
Application:IF, Human, Human embryonic stem cells, Human oocytes.
-
Rattus norvegicus Spermatogenesis Colony-Forming Assays.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com