SMURF1 monoclonal antibody (M01J), clone 1D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SMURF1 expression in transfected 293T cell line by SMURF1 monoclonal antibody (M01J), clone 1D7.
Lane 1: SMURF1 transfected lysate (Predicted MW: 83.4000000 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SMURF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of SMURF1 transfected lysate using anti-SMURF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SMURF1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMURF1 is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SMURF1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.18 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMURF1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SMURF1 expression in transfected 293T cell line by SMURF1 monoclonal antibody (M01J), clone 1D7.
Lane 1: SMURF1 transfected lysate (Predicted MW: 83.4000000 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SMURF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of SMURF1 transfected lysate using anti-SMURF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SMURF1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMURF1 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SMURF1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SMURF1
Entrez GeneID
57154GeneBank Accession#
NM_020429Protein Accession#
NP_065162Gene Name
SMURF1
Gene Alias
KIAA1625
Gene Description
SMAD specific E3 ubiquitin protein ligase 1
Omim ID
605568Gene Ontology
HyperlinkGene Summary
This gene encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. A similar protein in Xenopus is involved in embryonic pattern formation. Alternative splicing results in multiple transcript variants encoding different isoforms. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq
Other Designations
E3 ubiquitin ligase SMURF1|Smad ubiquitination regulatory factor 1|Smad-specific E3 ubiquitin ligase 1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com