SMURF1 monoclonal antibody (M01), clone 1D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMURF1.
Immunogen
SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SMURF1 monoclonal antibody (M01), clone 1D7. Western Blot analysis of SMURF1 expression in HeLa.Western Blot (Cell lysate)
SMURF1 monoclonal antibody (M01), clone 1D7. Western Blot analysis of SMURF1 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of SMURF1 expression in transfected 293T cell line by SMURF1 monoclonal antibody (M01), clone 1D7.
Lane 1: SMURF1 transfected lysate(83.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SMURF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 2 ug/ml]Immunoprecipitation
Immunoprecipitation of SMURF1 transfected lysate using anti-SMURF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SMURF1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMURF1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SMURF1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SMURF1
Entrez GeneID
57154GeneBank Accession#
NM_020429Protein Accession#
NP_065162Gene Name
SMURF1
Gene Alias
KIAA1625
Gene Description
SMAD specific E3 ubiquitin protein ligase 1
Omim ID
605568Gene Ontology
HyperlinkGene Summary
This gene encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. A similar protein in Xenopus is involved in embryonic pattern formation. Alternative splicing results in multiple transcript variants encoding different isoforms. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq
Other Designations
E3 ubiquitin ligase SMURF1|Smad ubiquitination regulatory factor 1|Smad-specific E3 ubiquitin ligase 1
-
Interactome
-
Pathway
-
Publication Reference
-
Role of SMURF1 ubiquitin ligase in BMP receptor trafficking and signaling.
Murakami K, Etlinger JD.
Cellular Signalling 2018 Nov; 54:139.
Application:WB, Human, HEK 293T cells.
-
BMPR2 Mutation-independent Mechanisms of Disrupted BMP Signaling in IPAH.
Barnes JW, Kucera ET, Tian L, Mellor NE, Dvorina N, Baldwin Iii WW, Aldred MA, Farver CF, Comhair SA, Aytekin M, Dweik RA.
American Journal of Respiratory Cell and Molecular Biology 2016 Oct; 55(4):564.
Application:IHC-P, Human, Lung.
-
Impaired phosphorylation and ubiquitination by P70 S6 kinase (P70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promotes Tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer.
Wang J, Zhang Y, Weng W, Qiao Y, Ma L, Xiao W, Yu Y, Pan Q, Sun F.
The Journal of Biological Chemistry 2013 Nov; 288(47):33667.
Application:IHC-P, Human, Liver cancer.
-
Smurf1 ubiquitin ligase causes downregulation of BMP receptors and is induced in monocrotaline and hypoxia models of pulmonary arterial hypertension.
Murakami K, Mathew R, Huang J, Farahani R, Peng H, Olson SC, Etlinger JD.
Experimental Biology and Medicine (Maywood, N.J.) 2010 Jul; 235(7):805.
Application:WB-Ti, Rat, Rat lungs.
-
Role of SMURF1 ubiquitin ligase in BMP receptor trafficking and signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com