Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMURF1 polyclonal antibody (A01)

  • Catalog # : H00057154-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SMURF1.
  • Immunogen:
  • SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057154-A01
    Western Blot detection against Immunogen (37.55 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SMURF1
  • Gene Alias:
  • KIAA1625
  • Gene Description:
  • SMAD specific E3 ubiquitin protein ligase 1
  • Gene Summary:
  • This gene encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. A similar protein in Xenopus is involved in embryonic pattern formation. Alternative splicing results in multiple transcript variants encoding different isoforms. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq
  • Other Designations:
  • E3 ubiquitin ligase SMURF1,Smad ubiquitination regulatory factor 1,Smad-specific E3 ubiquitin ligase 1
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook