SLURP1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SLURP1 full-length ORF ( NP_065160.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.6
Interspecies Antigen Sequence
Mouse (69); Rat (71)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SLURP1
Entrez GeneID
57152GeneBank Accession#
NM_020427.2Protein Accession#
NP_065160.1Gene Name
SLURP1
Gene Alias
ANUP, ARS, ArsB, LY6LS, MDM
Gene Description
secreted LY6/PLAUR domain containing 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq
Other Designations
ARS component B|ARS(component B)-81/S|anti-neoplastic urinary protein|lymphocyte antigen 6-like secreted|results in cobblestone changes in the skin of the palm|secreted Ly6/uPAR related protein 1
-
Interactome
-
Publication Reference
-
Endogenous CHRNA7-ligand SLURP1 as a potential tumor suppressor and anti-nicotinic factor in pancreatic cancer.
Throm VM, Männle D, Giese T, Bauer AS, Gaida MM, Kopitz J, Bruckner T, Plaschke K, Grekova SP, Felix K, Hackert T, Giese NA, Strobel O.
Oncotarget 2018 Jan; 9(14):11734.
Application：Func, Human, COLO357, PANC-1 cells.
-
SLURP-1, an endogenous α7 nicotinic acetylcholine receptor allosteric ligand, is expressed in CD205+ dendritic cells in human tonsils and potentiates lymphocytic cholinergic activity.
Fujii T, Horiguchi K, Sunaga H, Moriwaki Y, Misawa H, Kasahara T, Tsuji S, Kawashima K.
Journal of Neuroimmunology 2014 Feb; 267(1-2):43.
Application：Func, IHC, Human, MOLT-3 cells, Mononclear leukocytes, Tonsil.
-
Endogenous CHRNA7-ligand SLURP1 as a potential tumor suppressor and anti-nicotinic factor in pancreatic cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com