SLURP1 monoclonal antibody (M06), clone 4D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLURP1.
Immunogen
SLURP1 (NP_065160, 25 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (69); Rat (71)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.32 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SLURP1 expression in transfected 293T cell line by SLURP1 monoclonal antibody (M06), clone 4D1.
Lane 1: SLURP1 transfected lysate(11.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of SLURP1 transfected lysate using anti-SLURP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SLURP1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLURP1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — SLURP1
Entrez GeneID
57152GeneBank Accession#
NM_020427Protein Accession#
NP_065160Gene Name
SLURP1
Gene Alias
ANUP, ARS, ArsB, LY6LS, MDM
Gene Description
secreted LY6/PLAUR domain containing 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq
Other Designations
ARS component B|ARS(component B)-81/S|anti-neoplastic urinary protein|lymphocyte antigen 6-like secreted|results in cobblestone changes in the skin of the palm|secreted Ly6/uPAR related protein 1
-
Interactome
-
Publication Reference
-
Cholinergic Signaling Mechanisms and Early Implant Healing Phases in Healthy Versus Generalized Aggressive Periodontitis Patients: A prospective, case-control study.
Meriç P, Buduneli N, Kanmaz B, Gürlek Ö, Çömlekoğlu E, Calvert G, Lappin DF, Nile C.
Journal of Clinical Periodontology 2019 Nov; 46(11):1155.
Application:ELISA, Human, Peri‐implant crevicular fluid.
-
Down-regulation of secreted lymphocyte antigen-6/urokinase-type plasminogen activator receptor-related peptide-1 (SLURP-1), an endogenous allosteric alpha7 nicotinic acetylcholine receptor modulator, in murine and human asthmatic conditions.
Narumoto O, Horiguchi K, Horiguchi S, Moriwaki Y, Takano-Ohmuro H, Shoji S, Misawa H, Yamashita N, Nagase T, Kawashima K, Yamashita N.
Biochemical and Biophysical Research Communications 2010 Aug; 398(4):713.
Application:IHC-Fr, WB-Ti, Mouse, Mouse lungs.
-
Cholinergic Signaling Mechanisms and Early Implant Healing Phases in Healthy Versus Generalized Aggressive Periodontitis Patients: A prospective, case-control study.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com