Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLURP1 polyclonal antibody (A01)

  • Catalog # : H00057152-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLURP1.
  • Immunogen:
  • SLURP1 (NP_065160, 25 a.a. ~ 102 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057152-A01
    Western Blot detection against Immunogen (34.69 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SLURP1
  • Gene Alias:
  • ANUP,ARS,ArsB,LY6LS,MDM
  • Gene Description:
  • secreted LY6/PLAUR domain containing 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq
  • Other Designations:
  • ARS component B,ARS(component B)-81/S,anti-neoplastic urinary protein,lymphocyte antigen 6-like secreted,results in cobblestone changes in the skin of the palm,secreted Ly6/uPAR related protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook