CD177 monoclonal antibody (M01), clone 4C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CD177 expression in transfected 293T cell line by CD177 monoclonal antibody (M01), clone 4C4.
Lane 1: CD177 transfected lysate(46.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CD177 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of CD177 transfected lysate using anti-CD177 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD177 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD177 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CD177.
Immunogen
CD177 (AAH29167, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLW
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CD177 expression in transfected 293T cell line by CD177 monoclonal antibody (M01), clone 4C4.
Lane 1: CD177 transfected lysate(46.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CD177 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of CD177 transfected lysate using anti-CD177 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD177 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD177 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — CD177
Entrez GeneID
57126GeneBank Accession#
BC029167Protein Accession#
AAH29167Gene Name
CD177
Gene Alias
HNA2A, NB1, PRV1
Gene Description
CD177 molecule
Omim ID
162860Gene Ontology
HyperlinkGene Summary
NB1, a glycosyl-phosphatidylinositol (GPI)-linked N-glycosylated cell surface glycoprotein, was first described in a case of neonatal alloimmune neutropenia (Lalezari et al., 1971 [PubMed 5552408]).[supplied by OMIM
Other Designations
CD177 antigen|cell surface receptor|polycythemia rubra vera 1
-
Interactome
-
Publication Reference
-
Externalized histone H4 orchestrates chronic inflammation by inducing lytic cell death.
Silvestre-Roig C, Braster Q, Wichapong K, Lee EY, Teulon JM, Berrebeh N, Winter J, Adrover JM, Santos GS, Froese A, Lemnitzer P, Ortega-Gómez A, Chevre R, Marschner J, Schumski A, Winter C, Perez-Olivares L, Pan C, Paulin N, Schoufour T, Hartwig H, González-Ramos S, Kamp F, Megens RTA, Mowen KA, Gunzer M, Maegdefessel L, Hackeng T, Lutgens E, Daemen M, von Blume J, Anders HJ, Nikolaev VO, Pellequer JL, Weber C, Hidalgo A, Nicolaes GAF, Wong GCL, Soehnlein O.
Nature 2019 May; 569(7755):236.
Application：IHC-P, Human, Human carotid endarterectomy specimens.
-
Gene expression analysis of a Helicobacter pylori-infected and high-salt diet-treated mouse gastric tumor model: identification of CD177 as a novel prognostic factor in patients with gastric cancer.
Toyoda T, Tsukamoto T, Yamamoto M, Ban H, Saito N, Takasu S, Shi L, Saito A, Ito S, Yamamura Y, Nishikawa A, Ogawa K, Tanaka T, Tatematsu M.
BMC Gastroenterology 2013 Jul; 13:122.
Application：IHC-P, Human, Human gastric cancer tissues.
-
Externalized histone H4 orchestrates chronic inflammation by inducing lytic cell death.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com