Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SPINLW1 (Human) Recombinant Protein (P01)

  • Catalog # : H00057119-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SPINLW1 full-length ORF ( NP_065131.1, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00057119-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SPINLW1
  • Gene Alias:
  • EPPIN,EPPIN1,EPPIN2,EPPIN3,WAP7,WFDC7,dJ461P17.2
  • Gene Description:
  • serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin)
  • Gene Summary:
  • This gene encodes an epididymal protease inhibitor, which contains both kunitz-type and WAP-type four-disulfide core (WFDC) protease inhibitor consensus sequences. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene is a member of the WFDC gene family and belongs to the telomeric cluster. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031137,OTTHUMP00000031138,WAP four-disulfide core domain 7,epididymal protease inhibitor,serine peptidase inhibitor-like, with Kunitz and WAP domains 1,serine protease inhibitor-like, with Kunitz and WAP domains 1 (eppin)
  • RSS
  • YouTube
  • Linkedin
  • Facebook