UTP3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human UTP3 protein.
Immunogen
UTP3 (NP_065101.1, 1 a.a. ~ 479 a.a) full-length human protein.
Sequence
MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSGDEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UTP3 MaxPab polyclonal antibody. Western Blot analysis of UTP3 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of UTP3 expression in transfected 293T cell line (H00057050-T01) by UTP3 MaxPab polyclonal antibody.
Lane1:SAS10 transfected lysate(52.69 KDa).
Lane2:Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SAS10 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — UTP3
Entrez GeneID
57050GeneBank Accession#
NM_020368.1Protein Accession#
NP_065101.1Gene Name
UTP3
Gene Alias
CRL1, CRLZ1, FLJ23256, SAS10
Gene Description
UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
Omim ID
611614Gene Ontology
HyperlinkGene Summary
small subunit (SSU) processome component
Other Designations
OTTHUMP00000160360|UTP3, small subunit processome component|charged amino acid rich leucine zipper 1 homolog|disrupter of silencing 10|something about silencing protein 10
-
Interactome
-
Publication Reference
-
HCP5 prevents ubiquitination-mediated UTP3 degradation to inhibit apoptosis by activating c-Myc transcriptional activity.
Yabing Nan, Qingyu Luo, Xiaowei Wu, Wan Chang, Pengfei Zhao, Shi Liu, Zhihua Liu.
Molecular Therapy 2023 Feb; 31(2):552.
Application:IF, PLA, Human, KYSE150, KYSE510 cells.
-
HCP5 prevents ubiquitination-mediated UTP3 degradation to inhibit apoptosis by activating c-Myc transcriptional activity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com