Product Browser

Last updated: 2017/5/28
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKR1B10 polyclonal antibody (A01)

  • Catalog # : H00057016-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AKR1B10.
  • Immunogen:
  • AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00057016-A01
    Western Blot detection against Immunogen (33.59 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • AKR1B10 polyclonal antibody (A01), Lot # UOP11060207QCS1. Western Blot analysis of AKR1B10 expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • AKR1B10 polyclonal antibody (A01), Lot # UOP11060207QCS1 Western Blot analysis of AKR1B10 expression in K-562 ( Cat # L009V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • AKR1B10
  • Gene Alias:
  • AKR1B11,AKR1B12,ALDRLn,ARL-1,ARL1,HIS,HSI,MGC14103
  • Gene Description:
  • aldo-keto reductase family 1, member B10 (aldose reductase)
  • Gene Summary:
  • This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq
  • Other Designations:
  • aldo-keto reductase family 1, member B10,aldo-keto reductase family 1, member B11 (aldose reductase-like),aldose reductase-like 1,aldose reductase-like peptide,aldose reductase-related protein,small intestine reductase
  • RSS
  • YouTube
  • Linkedin
  • Facebook