AKR1B10 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a partial recombinant AKR1B10.
Immunogen
AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag.
Sequence
VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.59 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AKR1B10 polyclonal antibody (A01), Lot # UOP11060207QCS1 Western Blot analysis of AKR1B10 expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
AKR1B10 polyclonal antibody (A01), Lot # UOP11060207QCS1. Western Blot analysis of AKR1B10 expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — AKR1B10
Entrez GeneID
57016GeneBank Accession#
NM_020299Protein Accession#
NP_064695Gene Name
AKR1B10
Gene Alias
AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI, MGC14103
Gene Description
aldo-keto reductase family 1, member B10 (aldose reductase)
Omim ID
604707Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq
Other Designations
aldo-keto reductase family 1, member B10|aldo-keto reductase family 1, member B11 (aldose reductase-like)|aldose reductase-like 1|aldose reductase-like peptide|aldose reductase-related protein|small intestine reductase
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
SUOX is a Promising Diagnostic and Prognostic Biomarker for Hepatocellular Carcinoma.
Jin GZ, Yu WL, Dong H, Zhou WP, Gu YJ, Yu H, Yu H, Lu XY, Xian ZH, Liu YK, Cong WM, Wu MC.
Journal of Hepatology 2013 Sep; 59(3):510.
Application:IHC-P, Human, Liver.
-
Proteasome inhibitors MG-132 and bortezomib induce AKR1C1; AKR1C3; AKR1B1; and AKR1B10 in human colon cancer cell lines SW-480 and HT-29.
Ebert B, Kisiela M, Wsol V, Maser E.
Chemico-biological Interactions 2011 May; 191(1-3):239.
Application:WB, Human, Caco-2, HT-29, HCT116, SW-480, A-549, PANC-1, A431, HepG2 cells.
-
Proteomic identification of aldo-keto reductase AKR1B10 induction after treatment of colorectal cancer cells with the proteasome inhibitor bortezomib.
Loeffler-Ragg J, Mueller D, Gamerith G, Auer T, Skvortsov S, Sarg B, Skvortsova I, Schmitz KJ, Martin HJ, Krugmann J, Alakus H, Maser E, Menzel J, Hilbe W, Lindner H, Schmid KW, Zwierzina H.
Molecular Cancer Therapeutics 2009 Jul; 8(7):1995.
Application:IHC-P, WB, Human, Caco-2, HRT-18, WiDr cells.
-
SUOX is a Promising Diagnostic and Prognostic Biomarker for Hepatocellular Carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com