TOMM22 monoclonal antibody (M01J), clone 4G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TOMM22 monoclonal antibody (M01J), clone 4G4. Western Blot analysis of TOMM22 expression in NIH/3T3.
Western Blot (Cell lysate)
TOMM22 monoclonal antibody (M01J), clone 4G4. Western Blot analysis of TOMM22 expression in Raw 264.7.
Western Blot (Cell lysate)
TOMM22 monoclonal antibody (M01J), clone 4G4. Western Blot analysis of TOMM22 expression in PC-12.
Western Blot (Transfected lysate)
Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody (M01J), clone 4G4.
Lane 1: TOMM22 transfected lysate (Predicted MW: 15.73 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small intestine. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOMM22 is 0.1 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi ( Cat # H00056993-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TOMM22 monoclonal antibody (M01), clone 4G4 (Cat # H00056993-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (41.36 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant TOMM22.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Host
Mouse
Reactivity
Human, Mouse, Rat
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.36 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TOMM22 monoclonal antibody (M01J), clone 4G4. Western Blot analysis of TOMM22 expression in NIH/3T3.Western Blot (Cell lysate)
TOMM22 monoclonal antibody (M01J), clone 4G4. Western Blot analysis of TOMM22 expression in Raw 264.7.Western Blot (Cell lysate)
TOMM22 monoclonal antibody (M01J), clone 4G4. Western Blot analysis of TOMM22 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody (M01J), clone 4G4.
Lane 1: TOMM22 transfected lysate (Predicted MW: 15.73 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOMM22 is 0.1 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi ( Cat # H00056993-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TOMM22 monoclonal antibody (M01), clone 4G4 (Cat # H00056993-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TOMM22
Entrez GeneID
56993GeneBank Accession#
BC009363Protein Accession#
AAH09363Gene Name
TOMM22
Gene Alias
1C9-2, MST065, MSTP065, TOM22
Gene Description
translocase of outer mitochondrial membrane 22 homolog (yeast)
Omim ID
607046Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq
Other Designations
mitochondrial import receptor Tom22
-
Interactome
-
Publication Reference
-
Mitochondrial translocase TOMM22 is overexpressed in pancreatic cancer and promotes aggressive growth by modulating mitochondrial protein import and function.
Mary Oluwadamilola Haastrup, Kunwar Somesh Vikramdeo, Shashi Anand, Mohammad Aslam Khan, James Elliot Carter, Seema Singh, Ajay Pratap Singh, Santanu Dasgupta.
Molecular Cancer Research : MCR 2023 Oct; [Epub]:0.
Application：WB, Human, BxPC3, HPAF, MIA PaCa, Panc1, PaTu 8902, SW1990, T3M4 cells.
-
Mitochondrial translocase TOMM22 is overexpressed in pancreatic cancer and promotes aggressive growth by modulating mitochondrial protein import and function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com