Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOMM22 monoclonal antibody (M01J), clone 4G4 CX Grade

  • Catalog # : H00056993-M01J
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant TOMM22.
  • Immunogen:
  • TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056993-M01J
    Western Blot detection against Immunogen (41.36 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunofluorescence
  • Immunofluorescence enlargeenlarge this image
  • Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell . [antibody concentration 10 ug/ml]
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small intestine. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • TOMM22
  • Gene Alias:
  • 1C9-2,MST065,MSTP065,TOM22
  • Gene Description:
  • translocase of outer mitochondrial membrane 22 homolog (yeast)
  • Gene Summary:
  • The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq
  • Other Designations:
  • mitochondrial import receptor Tom22
  • RSS
  • YouTube
  • Linkedin
  • Facebook