Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOMM22 polyclonal antibody (A03)

  • Catalog # : H00056993-A03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TOMM22.
  • Immunogen:
  • TOMM22 (NP_064628, 12 a.a. ~ 84 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056993-A03
    Western Blot detection against Immunogen (34.14 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TOMM22
  • Gene Alias:
  • 1C9-2,MST065,MSTP065,TOM22
  • Gene Description:
  • translocase of outer mitochondrial membrane 22 homolog (yeast)
  • Gene Summary:
  • The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq
  • Other Designations:
  • mitochondrial import receptor Tom22
  • RSS
  • YouTube
  • Linkedin
  • Facebook