TOMM22 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TOMM22 polyclonal antibody (A01), Lot # 051206JC01. Western Blot analysis of TOMM22 expression in Raw 264.7.
Western Blot (Cell lysate)
TOMM22 polyclonal antibody (A01), Lot # 051206JC01 Western Blot analysis of TOMM22 expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
TOMM22 polyclonal antibody (A01), Lot # 051206JC01. Western Blot analysis of TOMM22 expression in NIH/3T3.
Western Blot (Cell lysate)
TOMM22 polyclonal antibody (A01), Lot # 051206JC01. Western Blot analysis of TOMM22 expression in PC-12.
Western Blot detection against Immunogen (41.73 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant TOMM22.
Immunogen
TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag.
Sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Host
Mouse
Reactivity
Human, Mouse, Rat
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.73 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TOMM22 polyclonal antibody (A01), Lot # 051206JC01. Western Blot analysis of TOMM22 expression in Raw 264.7.Western Blot (Cell lysate)
TOMM22 polyclonal antibody (A01), Lot # 051206JC01 Western Blot analysis of TOMM22 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
TOMM22 polyclonal antibody (A01), Lot # 051206JC01. Western Blot analysis of TOMM22 expression in NIH/3T3.Western Blot (Cell lysate)
TOMM22 polyclonal antibody (A01), Lot # 051206JC01. Western Blot analysis of TOMM22 expression in PC-12.Western Blot (Recombinant protein)
ELISA
-
Gene Info — TOMM22
Entrez GeneID
56993GeneBank Accession#
BC009363Protein Accession#
AAH09363Gene Name
TOMM22
Gene Alias
1C9-2, MST065, MSTP065, TOM22
Gene Description
translocase of outer mitochondrial membrane 22 homolog (yeast)
Omim ID
607046Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq
Other Designations
mitochondrial import receptor Tom22
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com