Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NT5M monoclonal antibody (M02), clone 3E2

  • Catalog # : H00056953-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant NT5M.
  • Immunogen:
  • NT5M (AAH35838, 129 a.a. ~ 228 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • CTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Lambda
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056953-M02
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • NT5M
  • Gene Alias:
  • dNT-2,dNT2,mdN
  • Gene Description:
  • 5',3'-nucleotidase, mitochondrial
  • Gene Summary:
  • This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
  • Other Designations:
  • 5' nucleotidase, mitochondrial,5(3)-deoxyribonucleotidase,deoxy-5'-nucleotidase 2,mitochondrial 5' nucleotidase
  • RSS
  • YouTube
  • Linkedin
  • Facebook