TMEPAI monoclonal antibody (M01), clone 2A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TMEPAI.
Immunogen
TMEPAI (AAH15918, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TMEPAI is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — PMEPA1
Entrez GeneID
56937GeneBank Accession#
BC015918Protein Accession#
AAH15918Gene Name
PMEPA1
Gene Alias
STAG1, TMEPAI
Gene Description
prostate transmembrane protein, androgen induced 1
Omim ID
606564Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000031379|OTTHUMP00000174284|OTTHUMP00000174285|solid tumor-associated 1 protein|transmembrane prostate androgen-induced protein|transmembrane, prostate androgen induced RNA
-
Interactome
-
Publication Reference
-
Analysis of PMEPA1 Isoforms (a and b) as Selective Inhibitors of Androgen and TGF-β Signaling Reveals Distinct Biological and Prognostic Features in Prostate Cancer.
Sharad S, Sztupinszki ZM, Chen Y, Kuo C, Ravindranath L, Szallasi Z, Petrovics G, Sreenath TL, Dobi A, Rosner IL, Srinivasan A, Srivastava S, Cullen J, Li H.
Cancers 2019 Dec; 11(12):E1995.
Application:WB-Tr, Human, HEK 293, LNCaP cells.
-
Increased Smad3 and reduced Smad2 levels mediate the functional switch of TGF-β from growth suppressor to growth and metastasis promoter through TMEPAI/PMEPA1 in triple negative breast cancer.
Singha PK, Pandeswara S, Geng H, Lan R, Venkatachalam MA, Dobi A, Srivastava S, Saikumar P.
Genes & Cancer 2019 Jun; 10(5-6):134.
Application:WB, Human, 231-TMKD, BC1-BC5, BT-20, HCC1937, HMEC, Hs 578T, MDA-MB-157, MDA-MB-231, MDA-MB-453 cells.
-
Relationship between ETS Transcription Factor ETV1 and TGF-β-regulated SMAD Proteins in Prostate Cancer.
Oh S, Shin S, Song H, Grande JP, Janknecht R.
Scientific Reports 2019 Jun; 9(1):8186.
Application:IF, IHC, WB-Ti, Rat, Rat hippocampus.
-
TGF-β induced TMEPAI/PMEPA1 inhibits canonical Smad signaling through R-Smad sequestration and promotes non-canonical PI3K/Akt signaling by reducing PTEN in triple negative breast cancer.
Singha PK, Pandeswara S, Geng H, Lan R, Venkatachalam MA, Saikumar P.
Genes & Cancer 2014 Sep; 5(9-10):320.
Application:IHC-P, WB-Ce, WB-Tr, Human, MDA-MB-231, BT-20, MDA-MB-468, HCC1937 cells, Breast tissue, Breast cancer.
-
Mutation or Loss of p53 Differentially Modifies TGFβ Action in Ovarian Cancer.
O Hainmhire E, Quartuccio SM, Cheng W, Ahmed RA, King SM, Burdette JE.
PLoS One 2014 Feb; 9(2):e89553.
Application:WB-Ce, WB-Tr, Human, OVCA 420, OVCA-432, SKOV3 cells.
-
TMEPAI regulates EMT in lung cancer cells by modulating the ROS and IRS-1 signaling pathways.
Hu Y, He K, Wang D, Yuan X, Liu Y, Ji H, Song J.
Carcinogenesis 2013 Aug; 34(8):1764.
Application:WB-Ce, WB-Tr, Human, A-549, H1299, H358, H446, HCC827 cells.
-
Identification of two distinct carcinoma-associated fibroblast subtypes with differential tumor-promoting abilities in oral squamous cell carcinoma.
Costea DE, Hills A, Osman AH, Thurlow J, Kalna G, Huang X, Pena Murillo C, Parajuli H, Suliman S, Keerthi KK, Johannessen AC, Partridge M.
Cancer Research 2013 Jul; 73(13):3888.
Application:WB-Ce, Human, Human oral carcinoma-associated fibroblasts.
-
Transforming Growth Factor-{beta} (TGF-{beta})-Inducible Gene TMEPAI Converts TGF-{beta} from a Tumor Suppressor to a Tumor Promoter in Breast Cancer.
Singha PK, Yeh IT, Venkatachalam MA, Saikumar P.
Cancer Research 2010 Aug; 70(15):6377.
Application:WB-Ce, WB-Tr, Human, MCF-7, MDA-MB-231 cells.
-
TMEPAI, a Transmembrane TGF-beta-Inducible Protein, Sequesters Smad Proteins from Active Participation in TGF-beta Signaling.
Watanabe Y, Itoh S, Goto T, Ohnishi E, Inamitsu M, Itoh F, Satoh K, Wiercinska E, Yang W, Shi L, Tanaka A, Nakano N, Mommaas AM, Shibuya H, Ten Dijke P, Kato M.
Molecular Cell 2010 Jan; 37(1):123.
Application:IF, IHC, WB-Ce, WB-Tr, Human, Mouse, HaCaT cells, Mammary cancerous tissues, Mouse intestinal adenoma, NIH/3T3, NMuMG cells.
-
A feedback loop between the androgen receptor and a NEDD4 binding protein, PMEPA1 in prostate cancer cells.
Li H, Xu LL, Masuda K, Raymundo E, McLeod DG, Dobi A, Srivastava S.
The Journal of Biological Chemistry 2008 Aug; 283(43):28988.
Application:WB-Tr, Human, COS-7, HEK 293, LNCaP cells.
-
High level expression of STAG1/PMEPA1 in an androgen-independent prostate cancer PC3 subclone.
Hirokawa YS, Takagi A, Uchida K, Kozuka Y, Yoneda M, Watanabe M, Shiraishi T.
Cellular & Molecular Biology Letters 2007 Feb; 12(3):370.
Application:IHC-P, Mouse, Tumors from the transplanted mice.
-
Analysis of PMEPA1 Isoforms (a and b) as Selective Inhibitors of Androgen and TGF-β Signaling Reveals Distinct Biological and Prognostic Features in Prostate Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com