Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C1GALT1 polyclonal antibody (A01)

  • Catalog # : H00056913-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant C1GALT1.
  • Immunogen:
  • C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056913-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • C1GALT1 polyclonal antibody (A01), Lot # 060109JC01 Western Blot analysis of C1GALT1 expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • C1GALT1
  • Gene Alias:
  • C1GALT,T-synthase
  • Gene Description:
  • core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
  • Gene Summary:
  • The common core 1 O-glycan structure Gal-beta-1-3GalNAc-R is a precursor for many extended mucin-type O-glycan structures in animal cell surface and secreted glycoproteins. Core 1 is synthesized by the transfer of Gal from UDP-Gal to GalNAc-alpha-1-R by core 1 beta-3-galactosyltransferase (C1GALT1) (Ju et al., 2002 [PubMed 11677243]).[supplied by OMIM
  • Other Designations:
  • core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase,core 1 beta3-Gal-T
  • RSS
  • YouTube
  • Linkedin
  • Facebook