Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SPIRE1 polyclonal antibody (A01)

  • Catalog # : H00056907-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SPIRE1.
  • Immunogen:
  • SPIRE1 (NP_064533, 482 a.a. ~ 583 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056907-A01
    Western Blot detection against Immunogen (37.33 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SPIRE1
  • Gene Alias:
  • MGC150621,MGC150622,Spir-1
  • Gene Description:
  • spire homolog 1 (Drosophila)
  • Gene Summary:
  • Spire proteins, such as SPIRE1, are highly conserved between species. They belong to the family of Wiskott-Aldrich homology region-2 (WH2) proteins, which are involved in actin organization (Kerkhoff et al., 2001 [PubMed 11747823]).[supplied by OMIM
  • Other Designations:
  • spire homolog 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook