AGPAT4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of AGPAT4 expression in transfected 293T cell line (H00056895-T01) by AGPAT4 MaxPab polyclonal antibody.
Lane 1: AGPAT4 transfected lysate(41.58 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human AGPAT4 protein.
Immunogen
AGPAT4 (NP_064518.1, 1 a.a. ~ 378 a.a) full-length human protein.
Sequence
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of AGPAT4 expression in transfected 293T cell line (H00056895-T01) by AGPAT4 MaxPab polyclonal antibody.
Lane 1: AGPAT4 transfected lysate(41.58 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AGPAT4
Entrez GeneID
56895GeneBank Accession#
NM_020133.2Protein Accession#
NP_064518.1Gene Name
AGPAT4
Gene Alias
1-AGPAT4, LPAAT-delta, dJ473J16.2
Gene Description
1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq
Other Designations
1-AGP acyltransferase 4|1-acyl-sn-glycerol-3-phosphate acyltransferase delta|1-acylglycerol-3-phosphate O-acyltransferase 4|OTTHUMP00000017554|lysophosphatidic acid acyltransferase-delta (LPAAT-delta)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Golgi membrane fission requires the CtBP1-S/BARS-induced activation of lysophosphatidic acid acyltransferase δ.
Pagliuso A, Valente C, Giordano LL, Filograna A, Li G, Circolo D, Turacchio G, Marzullo VM, Mandrich L, Zhukovsky MA, Formiggini F, Polishchuk RS, Corda D, Luini A.
Nature Communications 2016 Jul; 7:12148.
Application：IF, WB-Tr, Human, Monkey, COS-7, HeLa cells.
-
Golgi membrane fission requires the CtBP1-S/BARS-induced activation of lysophosphatidic acid acyltransferase δ.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com