Product Browser

Last updated: 2017/3/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AGPAT3 polyclonal antibody (A01)

  • Catalog # : H00056894-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AGPAT3.
  • Immunogen:
  • AGPAT3 (NP_064517, 155 a.a. ~ 259 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056894-A01
    Western Blot detection against Immunogen (37.66 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • AGPAT3
  • Gene Alias:
  • LPAAT-GAMMA1,MGC4604
  • Gene Description:
  • 1-acylglycerol-3-phosphate O-acyltransferase 3
  • Gene Summary:
  • The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 1-AGP acyltransferase 3,1-acyl-sn-glycerol-3-phosphate acyltransferase gamma,OTTHUMP00000109479,OTTHUMP00000109480,OTTHUMP00000109482,lysophosphatidic acid acyltransferase-gamma1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook