C8orf4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human C8orf4 partial ORF ( NP_064515, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKAKRSHQAIIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.4
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — C8orf4
Entrez GeneID
56892GeneBank Accession#
NM_020130Protein Accession#
NP_064515Gene Name
C8orf4
Gene Alias
MGC22806, TC-1, TC1, hTC-1
Gene Description
chromosome 8 open reading frame 4
Omim ID
607702Gene Ontology
HyperlinkGene Summary
This gene encodes a small, monomeric, predominantly unstructured protein that functions as a positive regulator of the Wnt/beta-catenin signaling pathway. This protein interacts with a repressor of beta-catenin mediated transcription at nuclear speckles. It is thought to competitively block interactions of the repressor with beta-catenin, resulting in up-regulation of beta-catenin target genes. [provided by RefSeq
Other Designations
human thyroid cancer 1|thyroid cancer-1
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com