Product Browser

Last updated: 2020/7/5

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

BRUNOL4 (Human) Recombinant Protein (P01) 

  • Catalog # : H00056853-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BRUNOL4 full-length ORF (no protein_acc, 1 a.a. - 250 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • MNRPIQVKPADSESRGDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPVSAGPLGRGRGQRRAETPAPATPRRLSSLPKRQESMTLIPGLRQGRGSPGMLRNWPEVTQVENARGGVHTSFPWASADAASSKAPRGAGGVGAGQRHRQLRAEALEQVGLTRRPGRREPRPVWWSSSPTPTRSARCGECSRWLARWACSTPWPSLSGPTAPTLRQ
  • Theoretical MW (kDa):
  • 53.59999999999999
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00056853-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • BRUNOL4
  • Gene Alias:
  • BRUNOL-4,CELF4
  • Gene Description:
  • bruno-like 4, RNA binding protein (Drosophila)
  • Gene Summary:
  • Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Bruno -like 4, RNA binding protein,CUG-BP and ETR-3 like factor 4,LYST-interacting protein LIP9,RNA-binding protein BRUNOL4,bruno-like 4, RNA binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook