RAD18 monoclonal antibody (M03), clone 2B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in Hela S3 NE ( Cat # L013V3 ).
Immunofluorescence
Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAD18.
Immunogen
RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (65); Rat (76)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RAD18
Entrez GeneID
56852GeneBank Accession#
NM_020165Protein Accession#
NP_064550Gene Name
RAD18
Gene Alias
RNF73
Gene Description
RAD18 homolog (S. cerevisiae)
Omim ID
605256Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. [provided by RefSeq
Other Designations
RAD18, S. cerevisiae, homolog|postreplication repair protein hRAD18p
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com