Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAD18 monoclonal antibody (M03), clone 2B9

  • Catalog # : H00056852-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant RAD18.
  • Immunogen:
  • RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056852-M03
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in PC-12 ( Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RAD18
  • Gene Alias:
  • RNF73
  • Gene Description:
  • RAD18 homolog (S. cerevisiae)
  • Gene Summary:
  • The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. [provided by RefSeq
  • Other Designations:
  • RAD18, S. cerevisiae, homolog,postreplication repair protein hRAD18p
  • RSS
  • YouTube
  • Linkedin
  • Facebook