RAD18 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RAD18 protein.
Immunogen
RAD18 (NP_064550.2, 1 a.a. ~ 495 a.a) full-length human protein.
Sequence
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (65); Rat (76)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RAD18 MaxPab rabbit polyclonal antibody. Western Blot analysis of RAD18 expression in mouse stomach.Western Blot (Cell lysate)
RAD18 MaxPab rabbit polyclonal antibody. Western Blot analysis of RAD18 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of RAD18 expression in transfected 293T cell line (H00056852-T02) by RAD18 MaxPab polyclonal antibody.
Lane 1: RAD18 transfected lysate(56.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of RAD18 transfected lysate using anti-RAD18 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAD18 purified MaxPab mouse polyclonal antibody (B01P) (H00056852-B01P). -
Gene Info — RAD18
Entrez GeneID
56852GeneBank Accession#
NM_020165.2Protein Accession#
NP_064550.2Gene Name
RAD18
Gene Alias
RNF73
Gene Description
RAD18 homolog (S. cerevisiae)
Omim ID
605256Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. [provided by RefSeq
Other Designations
RAD18, S. cerevisiae, homolog|postreplication repair protein hRAD18p
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com