Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFNK (Human) Recombinant Protein (Q01)

  • Catalog # : H00056832-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNK partial ORF ( NP_064509, 35 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.19
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00056832-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • IFNK
  • Gene Alias:
  • RP11-27J8.1
  • Gene Description:
  • interferon, kappa
  • Gene Summary:
  • This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021169,interferon kappa,interferon-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook