IFNK monoclonal antibody (M01), clone 1B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IFNK.
Immunogen
IFNK (NP_064509, 35 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (35); Rat (38)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — IFNK
Entrez GeneID
56832GeneBank Accession#
NM_020124Protein Accession#
NP_064509Gene Name
IFNK
Gene Alias
RP11-27J8.1
Gene Description
interferon, kappa
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster. [provided by RefSeq
Other Designations
OTTHUMP00000021169|interferon kappa|interferon-like protein
-
Pathway
-
Disease
-
Publication Reference
-
Keratinocytes sense and eliminate CRISPR DNA through STING/IFN-κ activation and APOBEC3G induction.
Mrinal K Sarkar, Ranjitha Uppala, Chang Zeng, Allison C Billi, Lam C Tsoi, Austin Kidder, Xianying Xing, Bethany E Perez White, Shuai Shao, Olesya Plazyo, Sirisha Sirobhushanam, Enze Xing, Yanyun Jiang, Katherine A Gallagher, John J Voorhees, J Michelle Kahlenberg, Johann E Gudjonsson.
The Journal of Clinical Investigation 2023 Mar; e159393.
Application:IF, Human, N/TERT cells.
-
Interferon kappa (IFNk) is critical for normal wound repair and is decreased in diabetic wounds.
Sonya J Wolf, Christopher O Audu, Amrita Joshi, Aaron D denDekker, William J Melvin, Frank M Davis, Xianying Xing, Rachael Wasikowski, Lam Tsoi, Steven Kunkel, Johann E Gudjonsson, Mary X O'Riordan, J Michelle Kahlenberg, Katherine A Gallagher.
JCI Insight 2022 Mar; e152765.
Application:IHC, Human, Skin.
-
Interferon Kappa Is a Rheostat for Development of Psoriasiform Inflammation.
Mehrnaz Gharaee-Kermani, Shannon N Estadt, Lam C Tsoi, Sonya J Wolf, Jianhua Liu, Xianying Xing, Jonathon Theros, Tammi J Reed, Lori Lowe, Dennis Gruszka, Nicole L Ward, Johann E Gudjonsson, J Michelle Kahlenberg.
The Journal of Investigative Dermatology 2022 Jan; 142(1):155.
Application:IF, IHC-P, Mouse, Mouse psoriatic skin biopsies.
-
Experimental Methods for the Immunological Characterization of Paradoxical Psoriasis Reactions Induced by TNF-α Biologics.
Martina Morelli, Claudia Scarponi, Stefania Madonna, Cristina Albanesi.
Methods in Molecular Biology (Clifton, N.J.) 2021 Jan; 2248:155.
Application:IHC-P, Human, Human skin biopsies.
-
Human papillomavirus type 16 E5 inhibits interferon signaling and supports episomal viral maintenance.
Scott ML, Woodby BL, Ulicny J, Raikhy G, Orr AW, Songock WK, Bodily JM.
Journal of Virology 2020 Jan; 94(2):e01582.
Application:WB, Human, Human foreskin keratinocytes.
-
Paradoxical psoriasis induced by Tnf-α blockade shows immunological features typical of the early phase of psoriasis development.
Fania L, Morelli M, Scarponi C, Mercurio L, Scopelliti F, Cattani C, Scaglione GL, Tonanzi T, Pilla MA, Pagnanelli G, Mazzanti C, Girolomoni G, Cavani A, Madonna S, Albanesi C.
The Journal of Pathology. Clinical Research 2019 Oct; [Epub].
Application:IHC-P, Human, Skin.
-
Topical Plant Polyphenols Prevent Type I Interferon Signaling in the Skin and Suppress Contact Hypersensitivity.
Carbone ML, Lulli D, Passarelli F, Pastore S.
International Journal of Molecular Sciences 2018 Sep; 19(9):E2652.
Application:WB, IHC-P, Human, Cetuximab-associated skin inflammation manifesting in cancer patients, Human keratinocytes.
-
Photosensitivity and type I IFN responses in cutaneous lupus are driven by epidermal-derived interferon kappa.
Sarkar MK, Hile GA, Tsoi LC, Xing X, Liu J, Liang Y, Berthier CC, Swindell WR, Patrick MT, Shao S, Tsou PS, Uppala R, Beamer MA, Srivastava A, Bielas SL, Harms PW, Getsios S, Elder JT, Voorhees JJ, Gudjonsson JE, Kahlenberg JM.
Annals of the Rheumatic Diseases 2018 Nov; 77(11):1653.
Application:IF, WB-Ti, WB-Tr, Human, Skin, Keratinocytes.
-
High risk HPV repress constitutive interferon-kappa transcription via E6 to prevent pathogen recognition receptor and antiviral gene expression.
Reiser J, Hurst J, Voges M, Kraus P, Munch P, Iftner T, Stubenrauch F.
Journal of Virology 2011 Nov; 85(21):11372.
Application:WB-Tr, Human, HeLa, HPV18-1 cells.
-
Epigenetic silencing of interferon-kappa in human papillomavirus type 16-positive cells.
Rincon-Orozco B, Halec G, Rosenberger S, Muschik D, Nindl I, Bachmann A, Ritter TM, Dondog B, Ly R, Bosch FX, Zawatzky R, Rosl F.
Cancer Research 2009 Nov; 69(22):8718.
Application:IHC-P, WB-Tr, Human, Human cervical tissues, Human foreskin keratinocytes.
-
Keratinocytes sense and eliminate CRISPR DNA through STING/IFN-κ activation and APOBEC3G induction.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com