Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Research Area
  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Vote for Cancer Research Topics & Genes to Win One Free Antibody
pathway

IFNK monoclonal antibody (M01), clone 1B7

  • Catalog # : H00056832-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant IFNK.
  • Immunogen:
  • IFNK (NP_064509, 35 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056832-M01
    Western Blot detection against Immunogen (36.19 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • IFNK
  • Gene Alias:
  • RP11-27J8.1
  • Gene Description:
  • interferon, kappa
  • Gene Summary:
  • This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021169,interferon kappa,interferon-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook