ZC3HAV1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ZC3HAV1 partial ORF ( NP_078901.3, 601 a.a. - 699 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSRNYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (57); Rat (48)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ZC3HAV1
Entrez GeneID
56829GeneBank Accession#
NM_024625Protein Accession#
NP_078901.3Gene Name
ZC3HAV1
Gene Alias
DKFZp686F2052, DKFZp686H1869, DKFZp686O19171, FLB6421, FLJ13288, MGC48898, ZAP, ZC3H2, ZC3HDC2
Gene Description
zinc finger CCCH-type, antiviral 1
Omim ID
607312Gene Ontology
HyperlinkGene Summary
This gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms, are described. [provided by RefSeq
Other Designations
CCCH-type zinc finger antiviral protein|zinc finger CCCH type, antiviral 1|zinc finger antiviral protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com