Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZC3HAV1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00056829-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ZC3HAV1 partial ORF ( NP_078901.3, 601 a.a. - 699 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSRNYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00056829-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ZC3HAV1
  • Gene Alias:
  • DKFZp686F2052,DKFZp686H1869,DKFZp686O19171,FLB6421,FLJ13288,MGC48898,ZAP,ZC3H2,ZC3HDC2
  • Gene Description:
  • zinc finger CCCH-type, antiviral 1
  • Gene Summary:
  • This gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms, are described. [provided by RefSeq
  • Other Designations:
  • CCCH-type zinc finger antiviral protein,zinc finger CCCH type, antiviral 1,zinc finger antiviral protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook