Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RETN (Human) Recombinant Protein (Q01)

  • Catalog # : H00056729-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RETN partial ORF ( AAI01555.1, 20 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.20
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00056729-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RETN
  • Gene Alias:
  • ADSF,FIZZ3,MGC126603,MGC126609,RETN1,RSTN,XCP1
  • Gene Description:
  • resistin
  • Gene Summary:
  • This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. [provided by RefSeq
  • Other Designations:
  • C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1,found in inflammatory zone 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook