Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RETN monoclonal antibody (M23), clone 5E8

  • Catalog # : H00056729-M23
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant RETN.
  • Immunogen:
  • RETN (NP_065148, 20 a.a. ~ 106 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV*
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056729-M23
    Western Blot detection against Immunogen (35.57 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RETN
  • Gene Alias:
  • ADSF,FIZZ3,MGC126603,MGC126609,RETN1,RSTN,XCP1
  • Gene Description:
  • resistin
  • Gene Summary:
  • This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. [provided by RefSeq
  • Other Designations:
  • C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1,found in inflammatory zone 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook