Product Browser

Last updated: 2017/11/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RETN purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00056729-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human RETN protein.
  • Immunogen:
  • RETN (AAI01555.1, 1 a.a. ~ 108 a.a) full-length human protein.
  • Sequence:
  • MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RETN expression in transfected 293T cell line (H00056729-T01) by RETN MaxPab polyclonal antibody.

    Lane 1: RETN transfected lysate(11.40 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • RETN
  • Gene Alias:
  • ADSF,FIZZ3,MGC126603,MGC126609,RETN1,RSTN,XCP1
  • Gene Description:
  • resistin
  • Gene Summary:
  • This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. [provided by RefSeq
  • Other Designations:
  • C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1,found in inflammatory zone 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook