Product Browser

Last updated: 2017/1/15
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNK12 polyclonal antibody (A01)

  • Catalog # : H00056660-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KCNK12.
  • Immunogen:
  • KCNK12 (NP_071338, 166 a.a. ~ 215 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056660-A01
    Western Blot detection against Immunogen (31.61 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • KCNK12
  • Gene Alias:
  • THIK-2,THIK2
  • Gene Description:
  • potassium channel, subfamily K, member 12
  • Gene Summary:
  • This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq
  • Other Designations:
  • tandem pore domain potassium channel THIK-2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook