EIF5A2 monoclonal antibody (M01), clone 1E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of EIF5A2 expression in transfected 293T cell line by EIF5A2 monoclonal antibody (M01), clone 1E7.
Lane 1: EIF5A2 transfected lysate(16.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF5A2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EIF5A2.
Immunogen
EIF5A2 (NP_065123, 66 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EIF5A2 expression in transfected 293T cell line by EIF5A2 monoclonal antibody (M01), clone 1E7.
Lane 1: EIF5A2 transfected lysate(16.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF5A2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — EIF5A2
-
Interactome
-
Disease
-
Publication Reference
-
A Hypusine-eIF5A-PEAK1 Switch Regulates the Pathogenesis of Pancreatic Cancer.
Fujimura K, Wright T, Strnadel J, Kaushal S, Metildi C, Lowy AM, Bouvet M, Kelber JA, Klemke RL.
Cancer Research 2014 Nov; 74(22):6671.
Application：IHC-P, WB-Tr, Human, Normal pancreatic, Pancreatic cancer, HPNE, PANC1, 779E cells.
-
A Hypusine-eIF5A-PEAK1 Switch Regulates the Pathogenesis of Pancreatic Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com