Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DIABLO (Human) Recombinant Protein (P01)

  • Catalog # : H00056616-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DIABLO full-length ORF (BAG50903.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKSDFYFQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 47.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DIABLO
  • Gene Alias:
  • DIABLO-S,FLJ10537,FLJ25049,SMAC,SMAC3
  • Gene Description:
  • diablo homolog (Drosophila)
  • Gene Summary:
  • This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and it moderates the caspase inhibition of IAPs. Multiple polyadenylation sites have been found for this gene. Four alternatively spliced transcript variants have been described for this gene, with two of them encoding different isoforms and the other two probably not encoding a protein. [provided by RefSeq
  • Other Designations:
  • 0610041G12Rik,diablo,direct IAP-binding protein with low pI,mitochondrial Smac protein,second mitochondria-derived activator of caspase
  • RSS
  • YouTube
  • Linkedin
  • Facebook