Product Browser

Last updated: 2017/4/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC2A9 polyclonal antibody (A01)

  • Catalog # : H00056606-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC2A9.
  • Immunogen:
  • SLC2A9 (NP_001001290, 224 a.a. ~ 287 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056606-A01
    Western Blot detection against Immunogen (33.15 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SLC2A9 polyclonal antibody (A01), Lot # 060623JCS1 Western Blot analysis of SLC2A9 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SLC2A9
  • Gene Alias:
  • GLUT9,GLUTX,UAQTL2,URATv1
  • Gene Description:
  • solute carrier family 2 (facilitated glucose transporter), member 9
  • Gene Summary:
  • This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • human glucose transporter-like protein-9,solute carrier family 2, member 9 protein,urate voltage-driven efflux transporter 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook