TUBB4Q purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TUBB4Q MaxPab polyclonal antibody. Western Blot analysis of TUBB4Q expression in human placenta.
Western Blot (Cell lysate)
TUBB4Q MaxPab polyclonal antibody. Western Blot analysis of TUBB4Q expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of TUBB4Q expression in transfected 293T cell line (H00056604-T01) by TUBB4Q MaxPab polyclonal antibody.
Lane 1: TUBB4Q transfected lysate(47.74 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to TUBB4Q on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TUBB4Q protein.
Immunogen
TUBB4Q (AAI46476.1, 1 a.a. ~ 434 a.a) full-length human protein.
Sequence
MRELVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYVSRAVLVDLEPGTMDSVRSGPFGQVFRPDNFISRQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIWEEYPDRIINTLSILLLPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLCFPDQLNADLRKLAMNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMMAARDPRHGRYLTAAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPNNVKTAVCDIPPWGLKMSVTFTGNNTAVQELKRVSEQFTATFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEGGGV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TUBB4Q MaxPab polyclonal antibody. Western Blot analysis of TUBB4Q expression in human placenta.Western Blot (Cell lysate)
TUBB4Q MaxPab polyclonal antibody. Western Blot analysis of TUBB4Q expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of TUBB4Q expression in transfected 293T cell line (H00056604-T01) by TUBB4Q MaxPab polyclonal antibody.
Lane 1: TUBB4Q transfected lysate(47.74 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to TUBB4Q on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TUBB4Q
Entrez GeneID
56604GeneBank Accession#
BC146475Protein Accession#
AAI46476.1Gene Name
TUBB4Q
Gene Alias
-
Gene Description
tubulin, beta polypeptide 4, member Q
Gene Ontology
HyperlinkGene Summary
beta polypeptide 4
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
A Genome-Wide siRNA Screen to Identify Host Factors Necessary for Growth of the Parasite Toxoplasma gondii.
Moser LA, Pollard AM, Knoll LJ.
PLoS One 2013 Jun; 8(6):e68129.
Application：WB, Human, HeLa cells.
-
A Genome-Wide siRNA Screen to Identify Host Factors Necessary for Growth of the Parasite Toxoplasma gondii.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com