CYP26B1 monoclonal antibody (M01), clone 1H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CYP26B1 expression in transfected 293T cell line by CYP26B1 monoclonal antibody (M01), clone 1H6.
Lane 1: CYP26B1 transfected lysate (Predicted MW: 57.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CYP26B1.
Immunogen
CYP26B1 (NP_063938, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CYP26B1 expression in transfected 293T cell line by CYP26B1 monoclonal antibody (M01), clone 1H6.
Lane 1: CYP26B1 transfected lysate (Predicted MW: 57.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CYP26B1
Entrez GeneID
56603GeneBank Accession#
NM_019885Protein Accession#
NP_063938Gene Name
CYP26B1
Gene Alias
CYP26A2, DKFZp686G0638, MGC129613, P450RAI-2
Gene Description
cytochrome P450, family 26, subfamily B, polypeptide 1
Omim ID
605207Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid. [provided by RefSeq
Other Designations
cytochrome P450 retinoid metabolizing protein|cytochrome P450, family 26, subfamily b, polypeptide 1|retinoic acid-metabolizing cytochrome
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Expression of a Splice Variant of CYP26B1 in Betel Quid-Related Oral Cancer.
Chen PH, Lee KW, Hsu CC, Chen JY, Wang YH, Chen KK, Wang HM, Huang HW, Huang B.
TheScientificWorldJournal 2014 Jul; 2014:810561.
Application：WB-Ce, Human, HGF-1, Ca9-22 cells.
-
Cloning and functional studies of a splice variant of CYP26B1 expressed in vascular cells.
Elmabsout AA, Kumawat A, Saenz-Méndez P, Krivospitskaya O, Sävenstrand H, Olofsson PS, Eriksson LA, Strid A, Valen G, Törmä H, Sirsjö A.
PLoS One 2012 May; 7(5):e36839.
Application：WB-Tr, Human, Monkey , AOSMCs, COS-1, HUVECs.
-
CYP26B1 is a novel candidate gene for betel quid-related oral squamous cell carcinoma.
Chen PH, Lee KW, Chen CH, Shieh TY, Ho PS, Wang SJ, Lee CH, Yang SF, Chen MK, Chiang SL, Ko YC.
Oral Oncology 2011 Jul; 47(7):594.
Application：WB-Ti, Human, Oral squamous cell carcinoma.
-
The involvement of cytochrome p450 (CYP) 26 in the retinoic acid metabolism of human epidermal keratinocytes.
Pavez Lorie E, Li H, Vahlquist A, Torma H.
Biochimica et Biophysica Acta 2009 Mar; 1791(3):220.
Application：WB, Human, Keratinocytes.
-
Expression of a Splice Variant of CYP26B1 in Betel Quid-Related Oral Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com